DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and CG6553

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:420 Identity:85/420 - (20%)
Similarity:116/420 - (27%) Gaps:218/420 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 CYGNE------FQCHDGSCIPQNWQCDKIKDCQGGEDED-EQC--LVCEPDEFRCRSNEKCLVEK 487
            |.|::      .:|..|.||..:..||...:|..|.||. ..|  :.|....||| |...|:...
  Fly    23 CLGSQNATSCGHRCGGGDCIQLDQLCDGSANCLDGSDETVAMCEKVWCPGYAFRC-SYGACIAST 86

  Fly   488 YRCDQNIDCMDGSDEQ-----------DCDEY----GSGDLAPFDESELNAFPRVFTYASFLSPN 537
            ..||...||:||||||           :||.:    .||              :..||:....  
  Fly    87 AVCDGVQDCVDGSDEQGWLCRAQMQQANCDNWEMYCSSG--------------QCMTYSKLCD-- 135

  Fly   538 ETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKGFVNFRDSKEIMMTSDS 602
                                                               ..||.::    .|.
  Fly   136 ---------------------------------------------------GIRDCRD----GDD 145

  Fly   603 ETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTTSTTTSSITST 667
            |.:          |:...|:.|                         |||.|:||||||.|  |.
  Fly   146 ELE----------SLCEGVTIP-------------------------TTTVSSTTSTTTES--SI 173

  Fly   668 PSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGKCITVSQLCDKQI------------ 720
            ..||.|  :|:....|.|||.           ||    :|:|: |.||.:..:            
  Fly   174 HRITPT--VPVTRKASRPNPL-----------QE----NGECV-VPQLPNVMVKHFTDAILTVGS 220

  Fly   721 ----------DCP-----DAADELMC--------------------------------------- 731
                      |||     ...::.:|                                       
  Fly   221 RVANGTRIYYDCPAEHRLKGENQNICQDALWARKFPYCETPQAYVFSLVIVIFCFLIVVLVFLIW 285

  Fly   732 -VYRERPSRRRLTSTTAPPTTSSAPPETST 760
             |.||..|||:.........|||..|:||:
  Fly   286 RVRRENGSRRQREEHIWLVETSSNLPQTSS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549
LDLa 432..464 CDD:238060 11/37 (30%)
LDLa 470..505 CDD:238060 16/45 (36%)
LDLa 697..731 CDD:238060 10/60 (17%)
CG6553NP_610911.1 LDLa 34..60 CDD:197566 8/25 (32%)
LDLa 70..101 CDD:197566 13/31 (42%)
LDLa 115..146 CDD:197566 9/101 (9%)
Frag1 <260..>303 CDD:287278 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.