DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and Cd320

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001014223.1 Gene:Cd320 / 362851 RGDID:1305860 Length:264 Species:Rattus norvegicus


Alignment Length:199 Identity:50/199 - (25%)
Similarity:70/199 - (35%) Gaps:73/199 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 AHESHKCEDPTRRRDYCYGNEFQC-HDGSCIPQNWQCDKIKDCQGGEDEDE----------QC-- 467
            ||...:...|  |...|..:.|:| ..|.|:|.:|:||..:||..|.||:|          ||  
  Rat    37 AHTLVQVSGP--RAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRIEPCAQNRQCQP 99

  Fly   468 --------------------------LVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCD 506
                                      ..|:..|.||..::.|:...:|||.:.||.|.|||..||
  Rat   100 QPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRCDGHPDCPDSSDELSCD 164

  Fly   507 EYGSGDLAPFDESELNAFPRVFTYASFLSPNETNDKVYTYITATTDEDA---GTETKFQIHQVAA 568
                                        :..|| ||::....|||...:   ..||.|:...||:
  Rat   165 ----------------------------TDTET-DKIFQEENATTSMSSMIVEKETSFRNVTVAS 200

  Fly   569 PAPP 572
            ...|
  Rat   201 AGHP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 3/10 (30%)
LDLa 432..464 CDD:238060 13/32 (41%)
LDLa 470..505 CDD:238060 14/34 (41%)
LDLa 697..731 CDD:238060
Cd320NP_001014223.1 LDLa 51..86 CDD:238060 14/34 (41%)
LDLa 128..163 CDD:238060 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.