DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and yl

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_996433.1 Gene:yl / 32367 FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster


Alignment Length:422 Identity:98/422 - (23%)
Similarity:146/422 - (34%) Gaps:121/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 IPIYNSDVLGELFDCNLYPDAHESHKC-------------EDPTRRRDYC--------YGN---- 435
            ||:..|..:|:           |||.|             |.|......|        .||    
  Fly   973 IPLAASSPVGQ-----------ESHPCQQQNGGCSHICVGEGPYHSICLCPAGFVYRDAGNRTCV 1026

  Fly   436 -----EFQCHDGSCIPQNWQCDKIKDCQGGEDE---DEQ-----CLVCEPDEFRCRSNEKCLVEK 487
                 ||:||.|.|:..|.:|:..:||....||   ||:     .::|.|::|.|.|.|:|:.::
  Fly  1027 EALDCEFRCHSGECLTMNHRCNGRRDCVDNSDEMNCDEEHRRKPKVLCSPNQFACHSGEQCVDKE 1091

  Fly   488 YRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRVFTYASFLSPNETNDK-VYTYITATT 551
            .|||...||.|.||||.|::        ||:|:.   ..|..:..      .|.| |.:.:....
  Fly  1092 RRCDNRKDCHDHSDEQHCEK--------FDKSKK---CHVHQHGC------DNGKCVDSSLVCDG 1139

  Fly   552 DEDAGTETKFQIHQVAAPAPP-----VNSSAEEGAGGPKGFVNFRDSKEIMMTSDSETKFKYSQR 611
            ..|.|..:...:.:..:...|     .:.|...|:....|.::..|.      ||...|..:.  
  Fly  1140 TNDCGDNSDELLCEATSRCEPGMFQCGSGSCIAGSWECDGRIDCSDG------SDEHDKCVHR-- 1196

  Fly   612 ANRTSVKFSVSAPTTPAARTSSAIPSSALVQQRERT-------------------TSTTTTSTTT 657
                      |.|..        :....|.|..:|:                   |.::|.:.:.
  Fly  1197 ----------SCPPD--------MQRCLLGQCLDRSLVCDGHNDCGDKSDELNCGTDSSTMNISC 1243

  Fly   658 STTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGK-CITVSQLCDKQID 721
            :......||...|...:.:..|..|..|...:.......|...|.:|.||: ||.....||.|.|
  Fly  1244 AEDQYQCTSNLKICLPSTVRCNGTTECPRGEDEADCGDVCSIYEFKCRSGRECIRREFRCDGQKD 1308

  Fly   722 CPDAADELMCVYRERPSRRRLTSTTAPPTTSS 753
            |.|.:|||.|   |........|...|.:|||
  Fly  1309 CGDGSDELSC---ELEKGHHNQSQIQPWSTSS 1337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 10/43 (23%)
LDLa 432..464 CDD:238060 15/51 (29%)
LDLa 470..505 CDD:238060 17/34 (50%)
LDLa 697..731 CDD:238060 16/34 (47%)
ylNP_996433.1 LDLa 90..124 CDD:238060
LDLa 131..166 CDD:238060
LDLa 184..216 CDD:238060
LDLa 227..262 CDD:238060
LDLa 271..302 CDD:238060
FXa_inhibition 352..387 CDD:291342
Ldl_recept_b 442..482 CDD:278487
LY 466..508 CDD:214531
Ldl_recept_b 529..569 CDD:278487
LY 553..595 CDD:214531
LY 596..637 CDD:214531
FXa_inhibition 669..700 CDD:291342
LY 774..815 CDD:214531
LDLa 1032..1062 CDD:238060 12/29 (41%)
LDLa 1074..1109 CDD:238060 17/34 (50%)
LDLa 1118..1152 CDD:238060 6/39 (15%)
LDLa 1157..1189 CDD:197566 6/37 (16%)
LDLa 1198..1232 CDD:238060 4/41 (10%)
LDLa 1243..1279 CDD:238060 6/35 (17%)
LDLa 1283..1318 CDD:238060 16/34 (47%)
LDLa 1340..1371 CDD:197566
FXa_inhibition 1388..1416 CDD:291342
EGF_CA 1418..1452 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.