DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and Lrp5

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001099791.2 Gene:Lrp5 / 293649 RGDID:1309329 Length:1600 Species:Rattus norvegicus


Alignment Length:405 Identity:96/405 - (23%)
Similarity:140/405 - (34%) Gaps:139/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 CRRICKAILEA---CSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDYCYGNEFQCHDG-- 442
            |..||.|..:.   ||.|:: ..:|..|..|.           |.||     |..::|.|..|  
  Rat  1224 CSHICIAKGDGTPRCSCPVH-LVLLQNLLTC
G-----------EPPT-----CSPDQFACATGEI 1271

  Fly   443 SCIPQNWQCDKIKDCQGGEDED--------------EQCL--------VCEPDEFRCRSNEKCLV 485
            .|||..|:||...:|....||:              .||:        ||.|::|||.|.: |::
  Rat  1272 DCIPGAWRCDGFPECADQSDEEGC
PVCSASQFPCARGQCVDLRLRCDAVCLPNQFRCASGQ-CVL 1335

  Fly   486 EKYRCDQNIDCMDGSDEQDCD---------EYGSGDLAPFDESELNAF---------PRV----F 528
            .|.:||...||.|||||..|:         ...|..:.|.....|:.|         .||    :
  Rat  1336 IKQQCDSFPDCADGSDELMCEINKPPSDDVPAHSSAIGPVIGIILSLFVMGGVYFVCQRVMCQRY 1400

  Fly   529 TYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAG----------- 582
            |.||...|:|       |:..|                  |..|:|..|..|:.           
  Rat  1401 TGASGPFPHE-------YVGGT------------------PHVPLNFIAPGGSQHGPFPGIPCSK 1440

  Fly   583 ---------GPKGFVNFRDSKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPAART------- 631
                     |.:|.|...|...:...|.|.     |.....|.....::.|.:||...       
  Rat  1441 SMMSSVSLVGGRGSVPLYDRNHVTGASSSS-----SSSTKATLYPPILNPPPSPATDPSLYNMDM 1500

  Fly   632 --SSAIPSSALVQQRE--RTTSTTTTSTTTSTTTSSITSTPSITSTTLIPINAATSEPNPY---- 688
              ||.|||:|...:..  |..:..||..:|....|..:::...||...:.:|   |:.:||    
  Rat  1501 FYSSNIPSTARPYRPYIIRGMAPPTTPCSTDVCDSDYSTSRWKTSKYYLDLN---SDSDPYPPPP 1562

  Fly   689 ----EVVTSLGGCPP 699
                :.:::...|||
  Rat  1563 TPHSQYLSAEDSCPP 1577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 12/46 (26%)
LDLa 432..464 CDD:238060 12/33 (36%)
LDLa 470..505 CDD:238060 17/34 (50%)
LDLa 697..731 CDD:238060 3/3 (100%)
Lrp5NP_001099791.2 NHL <37..>169 CDD:302697
NHL repeat 65..104 CDD:271320
LY 102..142 CDD:214531
NHL repeat 107..148 CDD:271320
Ldl_recept_b 163..203 CDD:278487
LY 187..229 CDD:214531
LY 230..271 CDD:214531
FXa_inhibition 299..336 CDD:291342
LY 366..406 CDD:214531
LY 408..450 CDD:214531
LY 451..494 CDD:214531
LY 495..537 CDD:214531
LY 538..571 CDD:214531
FXa_inhibition 605..640 CDD:291342
NHL 685..878 CDD:302697
LY 710..752 CDD:214531
NHL repeat 720..756 CDD:271320
NHL repeat 763..802 CDD:271320
NHL repeat 808..843 CDD:271320
NHL repeat 847..871 CDD:271320
FXa_inhibition 906..941 CDD:291342
LY 1060..1103 CDD:214531
LY 1104..1146 CDD:214531
FXa_inhibition 1217..1253 CDD:291342 9/29 (31%)
LDLa 1259..1295 CDD:238060 13/35 (37%)
LDLa 1321..1355 CDD:238060 17/34 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.