DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and LRP10

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_005267567.1 Gene:LRP10 / 26020 HGNCID:14553 Length:721 Species:Homo sapiens


Alignment Length:406 Identity:96/406 - (23%)
Similarity:131/406 - (32%) Gaps:99/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 LGELFDCNLYPDAHE---SHKCEDPTRRRDY--CYGNEFQCHDG------SCIPQNWQCDKIKDC 457
            |||    ..|.:|..   |..|.|.|...|.  |....|.|...      :|.....:|:....|
Human   335 LGE----RCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFC 395

  Fly   458 QGGEDEDEQCLVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELN 522
            ..|.|| .:|..|:|..|||| :|||:.|.:.||...||.|||||.||.               .
Human   396 ADGADE-RRCRHCQPGNFRCR-DEKCVYETWVCDGQPDCADGSDEWDCS---------------Y 443

  Fly   523 AFPRVFTYASFLS----------PNETNDKVYTYITATTDEDAG-TETKFQIHQVAAP------- 569
            ..||....|:.:.          ......|:|...|......|. :..:.:|.|..||       
Human   444 VLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRMEAEIVQQQAPPSYGQLI 508

  Fly   570 ----APPVNSSAEEGAGGPKGFVNFRDSKEIM---MTSDSETKFKYSQRAN------RTSVKFSV 621
                .|||.....|.........|.|...:|:   ||.......:..||..      |...::.:
Human   509 AQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGGPGARRRQRGRLMRRLVRRLRRWGL 573

  Fly   622 SAPTTPAARTSSA----IPSSALVQQRERTTSTTTTSTTTSTTTSSITSTPSITSTTLIPINAAT 682
            ...|...||.|.|    .||:|.::..:..|.....................|.:    |:.:|:
Human   574 LPRTNTPARASEARSQVTPSAAPLEALDGGTGPAREGGAVGGQDGEQAPPLPIKA----PLPSAS 634

  Fly   683 SEPNPYEVVTSLGGCP--PQELRCVSGKCITVSQLCDKQIDCPDAADELMCVYRERPSRRRLTST 745
            :.|.|..|..:.|..|  |.|...:||   .|..|                       |.||..:
Human   635 TSPAPTTVPEAPGPLPSLPLEPSLLSG---VVQAL-----------------------RGRLLPS 673

  Fly   746 TAPPTTSSAPPETSTA 761
            ..||..:.:||...||
Human   674 LGPPGPTRSPPGPHTA 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 8/25 (32%)
LDLa 432..464 CDD:238060 8/37 (22%)
LDLa 470..505 CDD:238060 19/34 (56%)
LDLa 697..731 CDD:238060 7/35 (20%)
LRP10XP_005267567.1 CUB 34..134 CDD:238001
LDLa 148..182 CDD:238060
CUB 200..310 CDD:238001
LDLa <338..361 CDD:238060 6/22 (27%)
LDLa 407..441 CDD:238060 19/34 (56%)
PRK04654 <581..683 CDD:135173 27/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.