DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and Vldlr

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_037287.2 Gene:Vldlr / 25696 RGDID:3963 Length:873 Species:Rattus norvegicus


Alignment Length:412 Identity:96/412 - (23%)
Similarity:133/412 - (32%) Gaps:163/412 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 APRDAVSMAAYDSLIRANCSVRAAEFICGALEPECRPLHIGQLPPCRRICKAILEACSIPIYNSD 402
            ||||:.:.|   |..:|.|.  :::|.|                 ....|..:|..|.       
  Rat    18 APRDSGATA---SGKKAKCD--SSQFQC-----------------TNGRCITLLWKCD------- 53

  Fly   403 VLGELFDCNLYPDAHESHKCEDPTRRRDYCYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDED-EQ 466
              |: .||.   |..:...|...|     |..::|.|.:|.|:|..||||...||:.|.||. ||
  Rat    54 --GD-EDCT---DGSDEKNCVKKT-----CAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQ 107

  Fly   467 C--LVCEPDEFRC--RSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRV 527
            |  ..|..:|..|  ||.: |:.|.:|||...||.:|.||::|..                    
  Rat   108 CHMRTCRINEISCGARSTQ-CIPESWRCDGENDCDNGEDEENCGN-------------------- 151

  Fly   528 FTYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKGFV-NFR 591
                               ||.:.||                     .:...|....:.|| |.:
  Rat   152 -------------------ITCSADE---------------------FTCSSGRCVSRNFVCNGQ 176

  Fly   592 DSKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPA----ARTSSAIPSSALVQQRERTTSTTT 652
            |.                  .:..|.:...:.||..|    ..|||.||.|.:..          
  Rat   177 DD------------------CDDGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCD---------- 213

  Fly   653 TSTTTSTTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGKCITVSQLCD 717
                 .....|..|..|:......|:           :.|.   ||..|::|.||:||.....||
  Rat   214 -----DDADCSDQSDESLEQCGRQPV-----------IHTK---CPTSEIQCGSGECIHKKWRCD 259

  Fly   718 KQIDCPDAADELMCVYRERPSR 739
            ...||.|.:||:.|     |||
  Rat   260 GDPDCKDGSDEVNC-----PSR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 18/88 (20%)
LDLa 432..464 CDD:238060 14/31 (45%)
LDLa 470..505 CDD:238060 15/36 (42%)
LDLa 697..731 CDD:238060 15/33 (45%)
VldlrNP_037287.2 LDLa 33..67 CDD:238060 10/65 (15%)
LDLa 71..103 CDD:197566 14/36 (39%)
Ldl_recept_a 111..149 CDD:395011 15/38 (39%)
Ldl_recept_a 153..188 CDD:395011 9/73 (12%)
LDLa 192..224 CDD:197566 10/46 (22%)
Ldl_recept_a 237..273 CDD:395011 16/38 (42%)
Ldl_recept_a 276..312 CDD:395011 1/1 (100%)
Ldl_recept_a 320..350 CDD:395011
FXa_inhibition 360..394 CDD:405372
EGF_CA 396..426 CDD:214542
LDL-receptor class B 1 439..480
LY 461..499 CDD:214531
LDL-receptor class B 2 481..524
Ldl_recept_b 481..521 CDD:395012
LY 508..547 CDD:214531
LDL-receptor class B 3 525..567
LDL-receptor class B 4 568..611
Ldl_recept_b 568..608 CDD:395012
LY 592..634 CDD:214531
LDL-receptor class B 5 612..654
LDL-receptor class B 6 655..697
Ldl_recept_b 655..694 CDD:395012
FXa_inhibition 706..749 CDD:405372
Clustered O-linked oligosaccharides 751..790
Endocytosis signal. /evidence=ECO:0000255 832..837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.