DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and F14B4.1

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_492474.2 Gene:F14B4.1 / 172750 WormBaseID:WBGene00008779 Length:722 Species:Caenorhabditis elegans


Alignment Length:201 Identity:47/201 - (23%)
Similarity:68/201 - (33%) Gaps:71/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 QSTMLPMCQGVLDYDLTFNREGAAPRDAVSMAAYDSLIRANCSVRAAEFIC-----GALEPECRP 374
            |:.:||       |.|....:...|.:.           :.|..|..:.:|     ||....|  
 Worm   561 QTALLP-------YSLKVFHKSLQPEET-----------STCETRGCDQLCLLGENGAATCAC-- 605

  Fly   375 LHIGQLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDYCYGNEFQC 439
                                          ||.||.     .::..||.      ..|..::.:|
 Worm   606 ------------------------------GEGFDL-----LNDGKKCS------SNCSESQIEC 629

  Fly   440 --HDGSCIPQNWQCDKIKDCQGGEDEDEQC--LVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGS 500
              .|..||.:.:.||.:..|....|| |:|  .:|.|.:|:|..|.|||.....||:..||.|.|
 Worm   630 GGADPKCISKIYLCDGLAQCSNQADE-EKCPPRICLPGQFQCHDNHKCLPPGGLCDKVTDCSDSS 693

  Fly   501 DEQDCD 506
            ||..|:
 Worm   694 DEIYCE 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 18/116 (16%)
LDLa 432..464 CDD:238060 9/33 (27%)
LDLa 470..505 CDD:238060 16/34 (47%)
LDLa 697..731 CDD:238060
F14B4.1NP_492474.2 vWFA <272..313 CDD:294047
LY 343..383 CDD:214531
LY 391..425 CDD:214531
Ldl_recept_b 448..486 CDD:278487
LY 470..512 CDD:214531
LY 513..549 CDD:214531
FXa_inhibition 588..618 CDD:291342 8/66 (12%)
LDLa 622..658 CDD:238060 11/36 (31%)
LDLa 663..698 CDD:238060 16/34 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.