Sequence 1: | NP_609130.1 | Gene: | CG6739 / 34037 | FlyBaseID: | FBgn0031926 | Length: | 787 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492474.2 | Gene: | F14B4.1 / 172750 | WormBaseID: | WBGene00008779 | Length: | 722 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 47/201 - (23%) |
---|---|---|---|
Similarity: | 68/201 - (33%) | Gaps: | 71/201 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 QSTMLPMCQGVLDYDLTFNREGAAPRDAVSMAAYDSLIRANCSVRAAEFIC-----GALEPECRP 374
Fly 375 LHIGQLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDYCYGNEFQC 439
Fly 440 --HDGSCIPQNWQCDKIKDCQGGEDEDEQC--LVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGS 500
Fly 501 DEQDCD 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6739 | NP_609130.1 | CRD_FZ | 314..427 | CDD:143549 | 18/116 (16%) |
LDLa | 432..464 | CDD:238060 | 9/33 (27%) | ||
LDLa | 470..505 | CDD:238060 | 16/34 (47%) | ||
LDLa | 697..731 | CDD:238060 | |||
F14B4.1 | NP_492474.2 | vWFA | <272..313 | CDD:294047 | |
LY | 343..383 | CDD:214531 | |||
LY | 391..425 | CDD:214531 | |||
Ldl_recept_b | 448..486 | CDD:278487 | |||
LY | 470..512 | CDD:214531 | |||
LY | 513..549 | CDD:214531 | |||
FXa_inhibition | 588..618 | CDD:291342 | 8/66 (12%) | ||
LDLa | 622..658 | CDD:238060 | 11/36 (31%) | ||
LDLa | 663..698 | CDD:238060 | 16/34 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |