DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and F14B4.1

DIOPT Version :10

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_492474.2 Gene:F14B4.1 / 172750 WormBaseID:WBGene00008779 Length:722 Species:Caenorhabditis elegans


Alignment Length:201 Identity:47/201 - (23%)
Similarity:68/201 - (33%) Gaps:71/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 QSTMLPMCQGVLDYDLTFNREGAAPRDAVSMAAYDSLIRANCSVRAAEFIC-----GALEPECRP 374
            |:.:||       |.|....:...|.:.           :.|..|..:.:|     ||....|  
 Worm   561 QTALLP-------YSLKVFHKSLQPEET-----------STCETRGCDQLCLLGENGAATCAC-- 605

  Fly   375 LHIGQLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDYCYGNEFQC 439
                                          ||.||.     .::..||.      ..|..::.:|
 Worm   606 ------------------------------GEGFDL-----LNDGKKCS------SNCSESQIEC 629

  Fly   440 --HDGSCIPQNWQCDKIKDCQGGEDEDEQC--LVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGS 500
              .|..||.:.:.||.:..|....|| |:|  .:|.|.:|:|..|.|||.....||:..||.|.|
 Worm   630 GGADPKCISKIYLCDGLAQCSNQADE-EKCPPRICLPGQFQCHDNHKCLPPGGLCDKVTDCSDSS 693

  Fly   501 DEQDCD 506
            ||..|:
 Worm   694 DEIYCE 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 18/116 (16%)
LDLa 432..464 CDD:238060 9/33 (27%)
LDLa 470..505 CDD:238060 16/34 (47%)
LDLa 697..731 CDD:238060
F14B4.1NP_492474.2 vWFA <272..313 CDD:469594
LY 343..383 CDD:214531
LY 391..425 CDD:214531
Ldl_recept_b 448..487 CDD:459654
LY 470..512 CDD:214531
LY 513..549 CDD:214531
FXa_inhibition 588..618 CDD:464251 8/66 (12%)
LDLa 622..658 CDD:238060 11/36 (31%)
LDLa 663..698 CDD:238060 16/34 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.