DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and Lrp6

DIOPT Version :10

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_032540.2 Gene:Lrp6 / 16974 MGIID:1298218 Length:1613 Species:Mus musculus


Alignment Length:429 Identity:97/429 - (22%)
Similarity:139/429 - (32%) Gaps:140/429 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 DSLIRANCSVRAA----EFICGALEPECRPLHIGQLPPCRRICKAILEACSIPIYNSDVLGELFD 409
            |...|.:|.:...    |..||. .|.|.|...               .|    :..|:     |
Mouse  1223 DGTTRCSCPMHLVLLQDELSCGE-PPTCSPQQF---------------TC----FTGDI-----D 1262

  Fly   410 CNLYPDAHESHKCEDPTRRRDY--------CYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQ 466
            |  .|.|   .:|:..|...|:        |..::|||..|.||....:|:...:||...||...
Mouse  1263 C--IPVA---WRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNC 1322

  Fly   467 CLVCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRV---- 527
            .::|..|:||| :|.:|:.:..:||.::||.|.|||.||  |.:.:.||...:.:.:...|    
Mouse  1323 EVLCLIDQFRC-ANGQCVGKHKKCDHSVDCSDRSDELDC--YPTEEPAPQATNTVGSVIGVIVTI 1384

  Fly   528 -------FTYASFLSPNETNDKVYTYITATTDEDAGTETKFQIHQVAA------PAPPVNSSAEE 579
                   |.....|.|....|..    |.|.|        :.:|..|:      |.|...|.:..
Mouse  1385 FVSGTIYFICQRMLCPRMKGDGE----TMTND--------YVVHSPASVPLGYVPHPSSLSGSLP 1437

  Fly   580 GAGGPKGFVNFRDSKEIM-----------------MTSDSETK---------------------- 605
            |....|..::   |..||                 .:|.|.||                      
Mouse  1438 GMSRGKSMIS---SLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYT 1499

  Fly   606 --FKYSQRANRTSVKFS--------VSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTTSTT 660
              |.||..:..|...:|        .:.||||.   |:.:..|.....|..|:..|....|:...
Mouse  1500 MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPC---STDVCDSDYAPSRRMTSVATAKGYTSDVN 1561

  Fly   661 TSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPP 699
            ..|....|..|     |.:...|....||      .|||
Mouse  1562 YDSEPVPPPPT-----PRSQYLSAEENYE------SCPP 1589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 16/81 (20%)
LDLa 432..464 CDD:238060 11/31 (35%)
LDLa 470..505 CDD:238060 15/34 (44%)
LDLa 697..731 CDD:238060 3/3 (100%)
Lrp6NP_032540.2 YncE 1..204 CDD:442618
Beta-propeller 1 20..275
LY 89..127 CDD:214531
Ldl_recept_b 150..191 CDD:459654
LY 175..216 CDD:214531
LY 217..251 CDD:214531
LDL-receptor class B 5 236..277
FXa_inhibition 286..323 CDD:464251
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
Ldl_recept_b 458..499 CDD:459654
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:464251
Beta-propeller 3 631..890
YncE <654..813 CDD:442618
LY 697..739 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:464251
Beta-propeller 4 933..1202
LY 958..998 CDD:214531
YncE <968..1075 CDD:442618
Ldl_recept_b 1069..1110 CDD:459654
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:464251 4/19 (21%)
LDLa 1249..1285 CDD:238060 11/64 (17%)
LDLa 1288..1322 CDD:238060 12/33 (36%)
LDLa 1326..1360 CDD:238060 15/34 (44%)
PPPSP motif A 1487..1493 0/5 (0%)
PPPSP motif B 1527..1534 4/9 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1556..1613 11/45 (24%)
PPPSP motif C 1568..1575 3/11 (27%)
PPPSP motif D 1588..1593 2/2 (100%)
PPPSP motif E 1603..1610
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.