powered by:
Protein Alignment CG6739 and Dgcr2
DIOPT Version :9
Sequence 1: | NP_609130.1 |
Gene: | CG6739 / 34037 |
FlyBaseID: | FBgn0031926 |
Length: | 787 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034178.2 |
Gene: | Dgcr2 / 13356 |
MGIID: | 892866 |
Length: | 549 |
Species: | Mus musculus |
Alignment Length: | 101 |
Identity: | 24/101 - (23%) |
Similarity: | 34/101 - (33%) |
Gaps: | 42/101 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 424 DPTRRRDYCYGNEFQCHDGS--CIPQNWQCDKIKDCQGGEDEDEQCLVCEPDEFRCRSNEKCLVE 486
:|.|....|...:|.||.|: |||..||||....|:
Mouse 22 EPLRPELRCNPGQFACHGGTIQCIPLPWQCDGWPTCE---------------------------- 58
Fly 487 KYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELN 522
|.|||.||.|. :|:..|:.:..::
Mouse 59 -----------DKSDEADCPEV-TGEARPYGKETVD 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1215 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.