DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and cue

DIOPT Version :10

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_061504528.1 Gene:cue / 1270082 VectorBaseID:AGAMI1_012382 Length:734 Species:Anopheles gambiae


Alignment Length:115 Identity:27/115 - (23%)
Similarity:38/115 - (33%) Gaps:45/115 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 CNLYPDAHESHKCEDPTRRRDYCYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQCLVCEPDE 474
            |......:...:||:|....||||..|....||          |...|                 
Mosquito   465 CLCESTGYSGARCENPICGTDYCYNGECYVEDG----------KRPKC----------------- 502

  Fly   475 FRCRS---NEKCLVEKYRCDQNIDCMDGS----------DEQDCDEYGSG 511
             ||::   .|:|  |:|.|  |..|::|.          .|.:|.|..:|
Mosquito   503 -RCKAGYRGERC--EEYSC--NNYCLNGGHCTLGNETTVPECECGEEFAG 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 4/16 (25%)
LDLa 432..464 CDD:238060 7/31 (23%)
LDLa 470..505 CDD:238060 11/47 (23%)
LDLa 697..731 CDD:238060
cueXP_061504528.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.