DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and lrp2

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_012826499.2 Gene:lrp2 / 100489914 XenbaseID:XB-GENE-486052 Length:4662 Species:Xenopus tropicalis


Alignment Length:154 Identity:58/154 - (37%)
Similarity:69/154 - (44%) Gaps:37/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 NCSVRAAEFICGALEPECRPLHIGQLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHES 419
            |||.  :||.|                       |..:.|....|..|   .:||||   |..:.
 Frog  1186 NCSY--SEFKC-----------------------ASGDQCISTGYQCD---GVFDCN---DHSDE 1219

  Fly   420 HKCEDPTRRRDYCYGNEFQCH-DGSCIPQNWQCDKIKDCQGGEDEDEQCLV--CEPDEFRCRSNE 481
            ..|  |||....|:.|||||. ||:|||.||:||...||..|.||...|.|  |.|..||| .|.
 Frog  1220 LNC--PTRPAGMCHQNEFQCQSDGACIPSNWECDGHPDCIDGSDEHNTCPVRSCPPSMFRC-DNG 1281

  Fly   482 KCLVEKYRCDQNIDCMDGSDEQDC 505
            .|:...:.||.:.||.|.|||:||
 Frog  1282 NCIYRSWICDGDNDCRDMSDEKDC 1305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 17/71 (24%)
LDLa 432..464 CDD:238060 19/32 (59%)
LDLa 470..505 CDD:238060 15/34 (44%)
LDLa 697..731 CDD:238060
lrp2XP_012826499.2 LDLa 33..67 CDD:238060
LDLa 111..145 CDD:238060
LDLa 151..182 CDD:238060
LDLa 186..220 CDD:238060
LDLa 266..300 CDD:238060
EGF_CA 348..385 CDD:214542
NHL 391..618 CDD:302697
LY 503..548 CDD:214531
LY 551..591 CDD:214531
FXa_inhibition 663..704 CDD:405372
LY 776..818 CDD:214531
Ldl_recept_b 838..878 CDD:395012
LY 864..904 CDD:214531
LDLa 1026..1060 CDD:238060
LDLa 1067..1101 CDD:238060
LDLa 1109..1143 CDD:238060
LDLa 1149..1183 CDD:238060
LDLa 1187..1222 CDD:238060 14/65 (22%)
LDLa 1230..1264 CDD:238060 20/33 (61%)
LDLa 1271..1305 CDD:238060 15/34 (44%)
LDLa 1311..1344 CDD:197566
FXa_inhibition 1358..1393 CDD:405372
EGF_CA 1395..1434 CDD:214542
LY 1466..1505 CDD:214531
LY 1506..1548 CDD:214531
LY 1550..1594 CDD:214531
LY 1596..1637 CDD:214531
FXa_inhibition 1714..1745 CDD:405372
LY 1825..1857 CDD:214531
Ldl_recept_b 1888..1932 CDD:395012
LY 1917..1958 CDD:214531
FXa_inhibition 2027..2063 CDD:405372
LY 2187..2230 CDD:214531
LY 2232..2272 CDD:214531
FXa_inhibition 2351..2387 CDD:405372
LY 2463..2505 CDD:214531
Ldl_recept_b 2524..2564 CDD:395012
LY 2550..2590 CDD:214531
Ldl_recept_b 2608..2647 CDD:423042
FXa_inhibition 2660..2697 CDD:405372
LDLa 2705..2737 CDD:238060
LDLa 2746..2780 CDD:238060
LDLa 2785..2822 CDD:238060
LDLa 2826..2859 CDD:197566
LDLa 2868..2900 CDD:197566
LDLa 2910..2942 CDD:197566
LDLa 2953..2993 CDD:238060
LDLa 2998..3032 CDD:238060
LDLa <3046..3068 CDD:197566
LDLa 3080..3114 CDD:238060
FXa_inhibition 3126..3155 CDD:405372
vWFA <3152..3195 CDD:412136
LY 3224..3265 CDD:214531
LY 3267..3309 CDD:214531
Ldl_recept_b 3338..3378 CDD:395012
LY 3363..3404 CDD:214531
LY 3405..3446 CDD:214531
FXa_inhibition 3474..>3502 CDD:405372
LDLa 3517..3549 CDD:238060
LDLa 3558..3589 CDD:197566
LDLa 3598..3630 CDD:197566
LDLa 3639..3671 CDD:197566
LDLa 3724..3759 CDD:238060
LDLa 3764..3798 CDD:238060
LDLa 3802..3834 CDD:197566
LDLa 3847..3879 CDD:238060
LDLa 3890..3920 CDD:197566
LDLa 3933..3967 CDD:238060
LY 4146..4181 CDD:214531
Ldl_recept_b 4202..4242 CDD:395012
LY 4226..4269 CDD:214531
FXa_inhibition 4344..4371 CDD:405372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.