DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6739 and lrp3

DIOPT Version :9

Sequence 1:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_009301583.1 Gene:lrp3 / 100170796 ZFINID:ZDB-GENE-080116-3 Length:824 Species:Danio rerio


Alignment Length:378 Identity:80/378 - (21%)
Similarity:133/378 - (35%) Gaps:83/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 RICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTRRRDY---------CYGNEFQCH 440
            |:|.::|..   |..:|  .|.::   :|..:|.:...:....|..|         |..:|:.|.
Zfish   103 RLCGSVLPP---PFISS--RGRVW---VYFHSHANSSGQAQGFRMSY
IRGRLGQSSCEKDEYLCG 159

  Fly   441 DGSCIPQNWQCDKIKDCQGGEDEDEQ-CL---------VCEPDEFRCR--SNEKCLVEKYRCDQN 493
            :|.|:|::|:|:.:.:|  |::.||: |:         :|.|...:|.  .:.:||....||:..
Zfish   160 NGKCVPRSWRCNGLDEC--GDNTDERNC
VAPPTPARASLCPPGTLQCSDVQSTRCLPGSLRCNGA 222

  Fly   494 IDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRVFTYASFLSPNET--NDKVYTYITATTDEDAG 556
            .||.|||||..|.:...|       ..|..|...|....|..||.:  .|...|:...|.|    
Zfish   223 RDCPDGSDEARCPDTSCG-------KRLVNFYGTFASPDFFRPNRSTGTDLHCTWFLDTKD---- 276

  Fly   557 TETKFQIHQVAAPAPPV-NSSAEEGAG-GPKGFVNFRDSKEIMMTS----DSETKFKYSQRANRT 615
                        |.|.| ....:.|.| ..:.:....:..|.::.|    ::..:........:.
Zfish   277 ------------PKPLVLQVDLQLGVGDSVRVYDGLGEQAERLLQSLSHHNNHRRALLESSQGQM 329

  Fly   616 SVKFSVSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTTSTTTSSITSTPSITSTTLIPINA 680
            |: |..:.|.:|....::...........|....|.....:...........|........|:  
Zfish   330 SI-FYHAKPHSPGHGFNATYQVKGYCFPGEHPCGTDEGCYSDLQRCDGYWHCPGGRDEEACPL-- 391

  Fly   681 ATSEPNPYEVVTSLGGCPPQELRCV--SGKCITVSQLCDKQIDCPDAADELMC 731
                            |.|.|..|.  ||.|.:.|:.|:.|..|||.:||..|
Zfish   392 ----------------CQPGEYPCEGGSGACYSASERCNNQKKCPDGSDEKNC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 8/41 (20%)
LDLa 432..464 CDD:238060 10/31 (32%)
LDLa 470..505 CDD:238060 14/36 (39%)
LDLa 697..731 CDD:238060 15/35 (43%)
lrp3XP_009301583.1 CUB 31..141 CDD:238001 9/45 (20%)
LDLa 151..185 CDD:238060 12/35 (34%)
LDLa 197..234 CDD:238060 14/36 (39%)
CUB 239..350 CDD:238001 22/134 (16%)
LDLa 354..389 CDD:238060 3/34 (9%)
LDLa 392..428 CDD:238060 15/35 (43%)
LDLa 431..465 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.