DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and CYP96A3

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_176713.1 Gene:CYP96A3 / 842842 AraportID:AT1G65340 Length:503 Species:Arabidopsis thaliana


Alignment Length:440 Identity:107/440 - (24%)
Similarity:187/440 - (42%) Gaps:74/440 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GECL-----IYTKDLKYFESILSSS-TLLKKAHLYRFLRDFLGDGLLLSTGNKWTSRRKVLAPAF 135
            |.||     :.|.|......||||: ....|...::.:.:.:||.:.......|...|......|
plant    72 GPCLSGMDILLTVDPVNIHYILSSNFANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIF 136

  Fly   136 HFKCLENF---VEIMDRNSGIMVEKLKNYADGKTCVDL------FKF-VSLEALDVTTETAMGVQ 190
            ..:..:.|   ..:.....| :|..|:|.||....|||      |.| .||..:.......:.|:
plant   137 SNQDFQMFWVSTSVRKLRQG-LVPILENAADKNILVDLQDLFQRFLFDTSLILMTGYDPKCLSVE 200

  Fly   191 VNAQNEPNFPYTKAL----KSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQDFTDK 251
            :     |...:..|:    ..|.|...|.:....::|     |....|.:||::.:|:.....:|
plant   201 M-----PKVEFGDAVDGVSDGVFYRHVKPVFLWRLQY-----LIGVGVEKRLKRGLAVFDQLLEK 255

  Fly   252 VIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDIL-LQATIDN------KPLSDVDIREE 309
            :|..:|   |...:.||:.|           ::...:|:| ...|:|.      :|..|..|::.
plant   256 IITAKR---EEINSHGTHHP-----------SRGEAIDVLTYYMTMDTTKYKYLEPSDDRFIKDT 306

  Fly   310 VDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGP--DPDASVTQTKLLELKYLDCV 372
            :..|:.|..|||:|.::.....:|::|:....|.:| |:...|  ||      ..|.:|.||...
plant   307 ILGFLIAARDTTSSALTWFFWLMSKNPEAINKIRQE-VNKKMPRFDP------ADLEKLVYLHGA 364

  Fly   373 IKETMRLHPPVPILGR------YIPEDLKIGEITIPGNTSILLMPYYVYRDPEYFPDPLV-FKPE 430
            :.||:||:||||...:      .:|...::.|     ...|::..|.:.|....:.|... |:||
plant   365 VCETLRLYPPVPFNHKSPAKPDVLPSGHRVDE-----KWKIVISMYALGRMKSVWGDDAEDFRPE 424

  Fly   431 RWM-DMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYEL 479
            ||: |.....:.|...::.|::||:.|:|:|...||||.:.:::||:|::
plant   425 RWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYDI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 107/440 (24%)
CYP96A3NP_176713.1 p450 22..502 CDD:386267 107/440 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.