DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and CYP72C1

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:305 Identity:68/305 - (22%)
Similarity:113/305 - (37%) Gaps:65/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLGIAVLIMTLVWDNSRKQW-RVNTFEKSRILGPFTIPIVGNGLQAL--TLRPEN---------- 55
            |:|..:||:..||......| |....||......|:    ||..:.|  .:|..|          
plant    12 LIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFS----GNSYRILMGDMRESNQMDQVAHSLP 72

  Fly    56 ------FIQRFGDYFN----KYGKTFRLWILGECLIYTKDLKYFESILSSSTLLKK----AHLYR 106
                  |:.|...:.:    |:||....|......:...|.:....|:|...|..|    :|.:.
plant    73 LPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSKHELFPKPKIGSHNHV 137

  Fly   107 FLRDFLGDGLLLSTGNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLF 171
            ||     .|||...|.||:..|.:|.|||....|::.:...:.:...|:|:.:..|..|..::|.
plant   138 FL-----SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELD 197

  Fly   172 KFVSLEALDVTTETAM----------GVQV-NAQNEPNFPYTKALKSVVYIESKRLASVSMRYNW 225
            .:....  |:|.....          |::: ..|.|.......|:::|....||.|.:   ::| 
plant   198 SWTHCH--DLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSKFLPT---KFN- 256

  Fly   226 LFPLAAPLVYRRLQKDIAIMQDFTDKVIRERRAILERARADGTYK 270
                      |||::....|:.....:|..:...::|.|  ||.|
plant   257 ----------RRLRETERDMRAMFKAMIETKEEEIKRGR--GTDK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 58/273 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.