DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and CYP96A4

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:470 Identity:105/470 - (22%)
Similarity:198/470 - (42%) Gaps:64/470 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PIVG--NGLQALTLRPENFIQRFGDYFNKYGKTFRLWILGECLIYTKDLKYFESILSSSTL-LKK 101
            |::|  .|:.....|..:|:....:..|..|.....|:.|..::.|.|....:.||||:.: ..|
plant    38 PVLGMLPGVLFQIPRIYDFVTEALEAENMTGCFIGPWLSGTDILLTVDPVNIQYILSSNFVNYPK 102

  Fly   102 AHLYRFLRDFLGDGLLLSTGNKWTSRRKVLAPAFHFKCLENF---VEIMDRNSGIMVEKLKNYAD 163
            ...:..:.:|||||:.......|...|......|..:..::|   ..:...:.| :|..|.|..:
plant   103 GKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQG-LVPILDNAVE 166

  Fly   164 GKTCVDLFKFVSLEALDVTTETAMGVQVNAQN--EPNFPYTKALKSVV------YIESKRLASVS 220
            ....|||.........|.::....|....:.:  .|...:..|:..|.      :::...|.|:.
plant   167 KHILVDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEFADAMDGVADAMFYRHLKPAFLWSIQ 231

  Fly   221 MRYNWLFPLAAPLVYRRLQKDIAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKM 285
               :|:    ...:.:::::.:.:......|:|..:|   |..:..|.:        |..|:|  
plant   232 ---SWI----GVGIEKKMRRGLDVFDQMLGKIISAKR---EEIKNHGIH--------DSKGEA-- 276

  Fly   286 TLLDIL-LQATIDN------KPLSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIY 343
              :|:| ...|||.      ||.:|..||:.:...:.|..|||:|.::.....:|::|:....|.
plant   277 --MDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGLVIAARDTTSSALTWFFWLLSKNPEAMTKIR 339

  Fly   344 EELVSVLGP-DPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGR------YIPEDLKIGEITI 401
            :|:...:.. ||      ..|.:|.|||..:.||:||:|.||...:      .:|...|:.:   
plant   340 QEINKKMPKFDP------ADLDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDVLPSGHKVDK--- 395

  Fly   402 PGNTSILLMPYYVYRDPEYFPDPLV-FKPERWM-DMKTTSNTPPLAYIPFSSGPKNCIGQKFANL 464
              |..:::..|.:.|....:.|... |:||||: |...........::.|::||:.|:|::...|
plant   396 --NWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGKRLTFL 458

  Fly   465 QMKALISKVIRHYEL 479
            |||.:..::||:|::
plant   459 QMKTVAVEIIRNYDI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 105/470 (22%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 105/470 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.