DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and CYP96A12

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_195661.1 Gene:CYP96A12 / 830105 AraportID:AT4G39510 Length:508 Species:Arabidopsis thaliana


Alignment Length:514 Identity:113/514 - (21%)
Similarity:189/514 - (36%) Gaps:157/514 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YFNK-YGKTFRLW-ILG-----------------ECL-------------------IYTKDLKYF 89
            ||.| :|:.||.| ::|                 |.|                   ::|.|....
plant    23 YFKKPHGQVFRNWPVIGMLPGFLMVLHRIYNFGVEALEMSHLTFLFKGPWFAEMDMLFTVDPANI 87

  Fly    90 ESILSS--STLLKKAHLYRFLRDFLGDGLLLSTGNKWTSRRKV---------------------- 130
            ..||||  |...|.|. ::.:.|..|:.:..|....|.::||.                      
plant    88 HYILSSNFSNYTKGAD-FKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHQGFQKLSLSATRSKL 151

  Fly   131 ---LAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTTETAMGVQVN 192
               |.|.|:..|.|              ||:         |||.:.......|.|.....|....
plant   152 YDGLVPLFNQCCEE--------------EKV---------VDLQQVFQRFTFDTTFFIVTGFDPK 193

  Fly   193 AQN--EPNFPYTKAL----KSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQDFTDK 251
            :.:  .|...|.|||    :.:.|...|                 |..:.:||....:.|   :|
plant   194 SLSIEMPEVEYAKALDDLGEGIFYRHIK-----------------PKFFWKLQNRFGLGQ---EK 238

  Fly   252 VIRERRAILERARADGTYKPLIMGDDDI----------GGKAKMTLLDILLQATIDN--KPLSDV 304
            .:.|..|..:|..|    |.::...::|          |....:....|.|..|...  .|..|.
plant   239 RMTEADATFDRVSA----KYILAKREEIRSQGIDHHANGESEDLLTSHIKLDTTKYELLNPSDDK 299

  Fly   305 DIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVT------QTKL 363
            .:|:.:..|..||.|||:|.:|.....:|.:|:|...|.:|::       |.:::      |..|
plant   300 FLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKIRKEII-------DKNISKDGRNGQENL 357

  Fly   364 LELKYLDCVIKETMRLHPPV------PILGRYIPEDLKIGEITIPGNTSILLMPYYVYR-DPEYF 421
            .:|.||...:.|:|||:|||      ||....:|...|     :..|:.|::..:.:.| ...:.
plant   358 DKLVYLHAALYESMRLYPPVAFQRKSPIKPDVLPSGHK-----VEANSVIIIFLFALGRMRAVWG 417

  Fly   422 PDPLVFKPERWM-DMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYEL 479
            .|...||||||: :.....:.|...::.|::||:.|.|::.|...||.::.:::::|::
plant   418 EDATEFKPERWVSESGGLRHAPSFKFLSFNAGPRTCPGKQLAMTLMKTVVVEILQNYDI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 113/514 (22%)
CYP96A12NP_195661.1 CYP86A 66..498 CDD:410687 103/471 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.