DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and CYP704A2

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_182075.1 Gene:CYP704A2 / 819159 AraportID:AT2G45510 Length:511 Species:Arabidopsis thaliana


Alignment Length:519 Identity:126/519 - (24%)
Similarity:215/519 - (41%) Gaps:86/519 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLRPENFIQRFG---- 61
            |.||..||:.:.|.::                |:..|||.::   ::..|.:..| .:|:.    
plant     1 MEILTSIAITVATTIF----------------IVLCFTIYLM---IRIFTGKSRN-DKRYAPVHA 45

  Fly    62 -------------DYFNKYGK---TFRLWILGECLIYTKDLKYFESILSSS-TLLKKAHLYR-FL 108
                         ||..:..:   |:|....|:..|.|.|.:..|.||.:. ....|.|..| .:
plant    46 TVFDLLFHSDELYDYETEIAREKPTYRFLSPGQSEILTADPRNVEHILKTRFDNYSKGHSSRENM 110

  Fly   109 RDFLGDGLLLSTGNKWTSRRKVLAPAFHFKCLENF-VEIMDRNSGIMVEKLKNYADGKTCVDLFK 172
            .|.||.|:....|.||..:||:.:..|..:.|.:| ..:..||:..:|..:..:|......|...
plant   111 ADLLGHGIFAVDGEKWRQQRKLSSFEFSTRVLRDFSCSVFRRNASKLVGFVSEFALSGKAFDAQD 175

  Fly   173 FVSLEALDVTTETAMGVQ---VNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLV 234
            .:....||...:...||:   ::..::....:.:|........|.|......:..|.|.:.:   
plant   176 LLMRCTLDSIFKVGFGVELKCLDGFSKEGQEFMEAFDEGNVATSSRFIDPLWKLKWFFNIGS--- 237

  Fly   235 YRRLQKDIAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNK 299
            ..:|:|.||.:..|...:|..:|.  |.|:...|    ::.:|        .|...|:::..|.:
plant   238 QSKLKKSIATIDKFVYSLITTKRK--ELAKEQNT----VVRED--------ILSRFLVESEKDPE 288

  Fly   300 PLSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDA-------- 356
            .::|..:|:.:..|:.||.|||.:.:|..|:.:.::|.|||.|.:|:..|.......        
plant   289 NMNDKYLRDIILNFMIAGKDTTAALLSWFLYMLCKNPLVQEKIVQEIRDVTFSHEKTTDVNGFVE 353

  Fly   357 SVTQTKLLELKYLDCVIKETMRLHPPVPILGRYIPED--LKIGEITIPGNTSILL------MPYY 413
            |:.:..|.|:.||...:.||:||:||||:..|....|  |..|.....|:....:      |.|.
plant   354 SINEEALDEMHYLHAALSETLRLYPPVPVDMRCAENDDVLPDGHRVSKGDNIYYIAYAMGRMTYI 418

  Fly   414 VYRDPEYFPDPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHY 477
            ..:|.|      .||||||:.........|..:|.|.:||:.|:|:.||..||| ::|..:.|:
plant   419 WGQDAE------EFKPERWLKDGLFQPESPFKFISFHAGPRICLGKDFAYRQMK-IVSMALLHF 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 119/485 (25%)
CYP704A2NP_182075.1 PLN03195 15..509 CDD:215627 120/505 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H82150
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.