DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:492 Identity:150/492 - (30%)
Similarity:254/492 - (51%) Gaps:54/492 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RILGPFTIP----IVGNG--LQALTLRPENFIQRFGDYFNKYGKTFRLWILG--ECLIYTKDLKY 88
            |.|.||..|    ::|:.  ||      |:.::...:...|:...|..|: |  :...|..|..|
Mouse    41 RDLSPFPGPPAHWLLGHQKFLQ------EDNMETLDEIVKKHPCAFPCWV-GPFQAFFYIYDPDY 98

  Fly    89 FESILSSSTLLKKAHLYRFLRDFLGDGLLLSTGNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGI 153
             ..|..|.|..|..:|::.|...:|.|||...|.:|...|.:|.||||...|:..|:.|..:..:
Mouse    99 -AKIFLSRTDPKMQYLHQLLTPCIGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKV 162

  Fly   154 MVEKL-KNYADGKTCVDLFKFVSLEALDVTTETAMGVQVNAQ-NEPNFPYTKALKSVVYIESKRL 216
            |::|. |.:...:|.:::|:.::|..||:..:.|.|.:.|.| |.....|.||...:..|.|.||
Mouse   163 MLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRL 227

  Fly   217 ASVSMRYNWLFPLAAP-LVYRRLQKDIAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIG 280
            .:....::.:|.|:.. ..::.|.|   ::..:|:|:|::|:.||         |..:..||.  
Mouse   228 YNFWHHHDIIFKLSPKGHCFQELGK---VIHQYTEKIIQDRKKIL---------KNQVKQDDT-- 278

  Fly   281 GKAKMTLLDILLQATI-DNKPLSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYE 344
             :.....|||:|.|.. |.:..||.|:|.||:.|::||.|.:.:.:|..|:.::.:|:.|:....
Mouse   279 -QTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRT 342

  Fly   345 ELVSVLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGE-ITIPGNTSIL 408
            |:.|:||  ..:|:|..:|.|:.|....||||:||.||||.:.|.:.:.|.:.: .::|...:::
Mouse   343 EIRSILG--DGSSITWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVV 405

  Fly   409 LMPYYVYRDPEYFPDPLVFKPERWMDMKTTSNTP---PLAYIPFSSGPKNCIGQKFANLQMKALI 470
            |..:.::.:|..:.||.||.|.|:    |..|:.   |.|::||||||:|||||:||.|::|..|
Mouse   406 LSIWGLHHNPAVWNDPKVFDPLRF----TKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAI 466

  Fly   471 SKVIRHYELLPLGADLKATYTFILSSSTGNNVGLKPR 507
            :.::.|:::.|   ||.....|  ||.|    .|:|:
Mouse   467 ALILLHFQVAP---DLTRPPAF--SSHT----VLRPK 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 139/462 (30%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 146/486 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.