DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp313a5

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster


Alignment Length:486 Identity:124/486 - (25%)
Similarity:224/486 - (46%) Gaps:57/486 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLRPENFIQRFGDYFNKYGKTFRL 73
            :|.:..:|  ||:::.:...   ::.||...|.:|...:.:.|:.:..::..  .|..||||...
  Fly    13 ILCVYFLW--SRRRFYIMML---KLPGPMGFPFIGLAFEYIRLKRKIRLRTI--LFKIYGKTVLT 70

  Fly    74 WILGECLIYTKDLKYFESILSS------STLLKKAHLYRFLRDFLGDGLLLSTGNKWTSRRKVLA 132
            ||....::.|.:.|..|.|.:|      |:::.||     :...||.|||....|.|..|||:|.
  Fly    71 WIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKA-----ISSCLGLGLLTLKNNHWNERRKLLL 130

  Fly   133 PAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTTETAMGVQVNAQNEP 197
            |:|....:.:||.:::..:..:|..|..:.||.. ::|...::..:..:..:..||.:|  :|:.
  Fly   131 PSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGD-INLLPELNKWSFKIAAQITMGDEV--RNQA 192

  Fly   198 NFPYTKALKSVVYIESKRLASVSMRYNWLFP--LAAPLVY--RRLQ---KDIAIMQDFTDKVIRE 255
            |:.....|:|  |.....|..:.:...||..  |.....|  |||:   :..|.::|..||.:  
  Fly   193 NYQNGNLLES--YKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKDIIDKKL-- 253

  Fly   256 RRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIREEVDVFIFAGDDT 320
                   :..|.:.:|              .|:|.:|. .:....||..|:..|....|||..||
  Fly   254 -------SSTDNSSEP--------------ALIDRILN-LVRIGELSYDDVMGEFSNIIFAASDT 296

  Fly   321 TTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPI 385
            .:..|::.|..::..||.|:.::|||..|.....:...:...|.:|..||.|:.|||||.|.||:
  Fly   297 LSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPL 361

  Fly   386 LGRYIPEDLKIGE-ITIPGNTSILLMPYYVYRDPEYF-PDPLVFKPERWMDMKTTSNTPPLAYIP 448
            |.|.....:::.. ..||...::::..::.:|:.:.: |....|.|:.::.....:. ||.:|:|
  Fly   362 LIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRAR-PPYSYLP 425

  Fly   449 FSSGPKNCIGQKFANLQMKALISKVIRHYEL 479
            ||.|.|.|:|.|.:.:..|..::|::|:|.|
  Fly   426 FSKGKKTCLGWKLSLISAKLALAKILRNYML 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 120/460 (26%)
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 120/461 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.