DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:495 Identity:151/495 - (30%)
Similarity:256/495 - (51%) Gaps:44/495 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLGIAVLIMTLVWDNSRKQWRVNTFEKSRIL--------------GPFTIPIVGNGLQALTLRPE 54
            |:.||:::.|::           .|:..||.              ||...|.|||..| ..|:|.
  Fly     3 LIAIAIILATIL-----------VFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQ-FGLKPA 55

  Fly    55 NFIQRFGDYFNKYG-KTFRLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRDFLGDGLLL 118
            .:.::...|..||. :.||..:..:..:...|....::|||||:||.|.|||.|||.:||||||.
  Fly    56 EYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLT 120

  Fly   119 STGNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTT 183
            |:|.:|...:|:.||||....:|.::.::.|..|..|:||...:|.:...|..:.|:...||:..
  Fly   121 SSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVC 185

  Fly   184 ETAMGVQVNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQDF 248
            |.|.|...::.|........|:|.:..:..:|..|:..|::.||.|.:  .|.:.::.:::::..
  Fly   186 ENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTS--YYMKQRRALSLLRSE 248

  Fly   249 TDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPLSDVDIREEVDVF 313
            .:::|.:||   .:..|:.|.:.        |.......||:||.|.:|.|.|.:.:|.|||..|
  Fly   249 LNRIISQRR---HQLAAENTCQQ--------GQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTF 302

  Fly   314 IFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLLELKYLDCVIKETMR 378
            ||.|.|...:.:|..|:.:|||.::|:...||...:.|.:........:|.::.||:.:|:||:|
  Fly   303 IFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLR 367

  Fly   379 LHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEYFPDPLVFKPERWMDMKTTSNTPP 443
            |:|.||::.|.....:.|....:...|::::....:..:.:||.||..|:|||:.:  .|.|...
  Fly   368 LYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFEN--PTGNVGI 430

  Fly   444 LAY--IPFSSGPKNCIGQKFANLQMKALISKVIRHYELLP 481
            .|:  :|||:||:.||.:|||..|||||:|:::|.:|:||
  Fly   431 EAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 144/450 (32%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 142/449 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449027
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
109.900

Return to query results.
Submit another query.