DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp26b1

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_851601.2 Gene:Cyp26b1 / 312495 RGDID:631379 Length:512 Species:Rattus norvegicus


Alignment Length:532 Identity:123/532 - (23%)
Similarity:217/532 - (40%) Gaps:98/532 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGIAVLIMTLVWDNSRKQWRVN---TFEKSRIL----GPFTIPIV---------GNGLQALTLRP 53
            |...::.:||:...|::.|::.   |.:||..|    |....|::         |:|.|  :.|.
  Rat    15 LAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQ--SSRR 77

  Fly    54 ENFIQRFGDYFNKYGKTFRLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRDFLGDGLLL 118
            |           |||..|:..:||..||.....:....||.....|......|..|..||...:.
  Rat    78 E-----------KYGNVFKTHLLGRPLIRVTGAENVRKILLGEHQLVSTEWPRSARVLLGPNTVA 131

  Fly   119 -STGNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVT 182
             |.|:...::|||.:..|..:.||::   :.:...::.:.|:.::.....:::::........:.
  Rat   132 NSIGDIHRNKRKVFSKIFSHEALESY---LPKIQLVIQDTLRAWSSQPEAINVYQEAQRLTFRMA 193

  Fly   183 TETAMGVQVNAQNEPNF--PYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLV-YRRLQKDIAI 244
            ....:|..:..::..|.  .|.:.:::|                :..|:..|.. |||..:...|
  Rat   194 VRVLLGFSIPEEDLGNLFEVYQQFVENV----------------FSLPVDLPFSGYRRGIQARQI 242

  Fly   245 MQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDN-KPLSDVDIRE 308
            :|...:|.|||:....:                   ||.....||||::::.:: |.::..::::
  Rat   243 LQKGLEKAIREKLQCTQ-------------------GKDYSDALDILIESSKEHGKEMTMQELKD 288

  Fly   309 EVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEEL--VSVL--GPDPDASVTQTKLLE-LKY 368
            .....|||...||.|..:..:..:.:||.|.|.:.|||  ..:|  |..|.....:..:|. |:|
  Rat   289 GTLELIFAAYATTASASTSLIMQLLKHPAVLEKLREELRAQGLLHGGGCPCEGTLRLDMLSGLRY 353

  Fly   369 LDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPE----YFPDPLVFKP 429
            |||||||.|||..||....|.:.:..::....||...|::    |..||..    .|.|..||.|
  Rat   354 LDCVIKEVMRLFTPVSGGYRTVLQTFELDGFQIPKGWSVM----YSIRDTHDTAPVFKDVNVFDP 414

  Fly   430 ERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLPLGADLKATYTFIL 494
            :|:...::........|:||..|.:.|:|:..|.|.:|.             |..:|.:|..|.|
  Rat   415 DRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKV-------------LAVELASTSRFEL 466

  Fly   495 SSSTGNNVGLKP 506
            ::.|...:.|.|
  Rat   467 ATRTFPRITLVP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 106/469 (23%)
Cyp26b1NP_851601.2 CYP26B1 60..490 CDD:410730 112/487 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.