DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:424 Identity:144/424 - (33%)
Similarity:230/424 - (54%) Gaps:22/424 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SSSTLLKKAHLYRFLRDFLGDGLLLSTGNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKL 158
            |::...|:..||.||:.:||||||:|.|.||...|::|.|||||..|:::|:|.:::...|..|.
  Rat   115 SAAVAPKEMTLYGFLKPWLGDGLLMSAGEKWNHHRRLLTPAFHFDILKSYVKIFNKSVNTMHAKW 179

  Fly   159 KNY-ADGKTCVDLFKFVSLEALDVTTETAMGVQVNAQNEPNFPYTKALKSVVYIESKRLASVSMR 222
            :.. |.|...:|:|:.:||..||...:.......|.| |.|..|..|:..:..:..||.....:.
  Rat   180 QRLTAKGSARLDMFEHISLMTLDSLQKCIFSFDSNCQ-ESNSEYIAAILELSSLIVKRQRQPFLY 243

  Fly   223 YNWLFPLAAPLVYRRLQKDIAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAK--- 284
            .::|:.|.|.  .||.:|...::.:|||.||||||:.|.....|...|          .:||   
  Rat   244 LDFLYYLTAD--GRRFRKACDVVHNFTDAVIRERRSTLNTQGVDEFLK----------ARAKTKT 296

  Fly   285 MTLLDILLQATIDN-KPLSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVS 348
            :..:|:||.|..:: |.|||||||.|.|.|:|.|.|||.|.:|..|:.::|||:.||...:|:..
  Rat   297 LDFIDVLLLAKDEHGKGLSDVDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVRE 361

  Fly   349 VLGPDPDASVTQTKLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKI--GEITIPGNTSILLMP 411
            :|.......:....|.:|.:|...|||::||||||.::.|...:|:.:  |.:...||..::.: 
  Rat   362 LLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCSQDIVLPDGRVIPKGNICVISI- 425

  Fly   412 YYVYRDPEYFPDPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRH 476
            :.|:.:|..:|||.|:.|.|: |.:......|||:||||:||:|||||.||..::|..::..:..
  Rat   426 FGVHHNPSVWPDPEVYNPFRF-DPENPQKRSPLAFIPFSAGPRNCIGQTFAMSEIKVALALTLLR 489

  Fly   477 YELLPLGADLKATYTFILSSSTGNNVGLKPRTRV 510
            :.:||...:.:.....||.:..|..:.::|.:.|
  Rat   490 FCVLPDDKEPRRKPELILRAEGGLWLRVEPLSTV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 138/394 (35%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 142/414 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.