DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp3a62

DIOPT Version :9

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001019403.1 Gene:Cyp3a62 / 170509 RGDID:1595919 Length:497 Species:Rattus norvegicus


Alignment Length:503 Identity:136/503 - (27%)
Similarity:252/503 - (50%) Gaps:78/503 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLR------PENFIQRF 60
            |:||. .:|::..::..|..    ..|:|..|.||..:|.|||   .|..|      ..:..:::
  Rat    12 WMLLA-TILVLLYLYGTSTH----GNFKKLGISGPKPLPFVGN---ILAYRHGFWEFDRHCHKKY 68

  Fly    61 GDYFNKY-GKTFRLWILGECLIYTKDLKYFESILSS------STLLKKAHLYRFLRDFLGDGLLL 118
            ||.:..| |:...|.|....:|.|..:|...|..::      :.:||||             :.|
  Rat    69 GDIWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKA-------------ITL 120

  Fly   119 STGNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTT 183
            |...:|...|.:|:|.|....|:....|:::.:.::|:.:|:.|:....:.:.......::||.|
  Rat   121 SEDEEWKRLRTLLSPTFTSGKLKEMFPIINQYADLLVKNVKHEAEKGNPITMKDIFGAYSMDVIT 185

  Fly   184 ETAMGVQVNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNW---------LFPLAAPLVYRRLQ 239
            .|:.||.|::.|.|..|:.:.:|.:            :::|:         |||...| |:... 
  Rat   186 GTSFGVNVDSLNNPQNPFVQKVKKL------------LKFNFLDPFFLSVILFPFLTP-VFEAF- 236

  Fly   240 KDIAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILL--QATID---NK 299
             ||.:   |...|::..|..:||.:.:...:.:         |.::..|.:::  |::.|   ::
  Rat   237 -DITV---FPKDVMKFFRTSVERMKENRMQEKV---------KQRLDFLQLMINSQSSGDKESHQ 288

  Fly   300 PLSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQTKLL 364
            .|:||:|..:...|||||.:||:|.:|.||:.::.||.:|:.:.:|:.:.| |: .|.||...|:
  Rat   289 GLTDVEIVAQSIFFIFAGYETTSSALSFALYLLATHPDLQKKLQDEIDAAL-PN-KAPVTYDVLV 351

  Fly   365 ELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEYFPDPLVFKP 429
            |::|||.|:.||:||.|....|.|...:|::|..:.||..|.:::..:.:::||:.:|:|..|.|
  Rat   352 EMEYLDMVLNETLRLFPVGGRLERVCKKDVEINGVFIPKGTVVMVPTFALHKDPKCWPEPEEFCP 416

  Fly   430 ERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHY 477
            ||:. .|...:..|..|:||.:||:||||.:||.:.||..:.:|::::
  Rat   417 ERFR-KKNQDSINPYIYLPFGNGPRNCIGMRFALMNMKIALVRVLQNF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 p450 35..482 CDD:278495 128/470 (27%)
Cyp3a62NP_001019403.1 p450 39..491 CDD:278495 128/471 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.