DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d21 and Cyp51

DIOPT Version :10

Sequence 1:NP_609129.2 Gene:Cyp4d21 / 34036 FlyBaseID:FBgn0031925 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_064394.2 Gene:Cyp51 / 13121 MGIID:106040 Length:503 Species:Mus musculus


Alignment Length:64 Identity:18/64 - (28%)
Similarity:32/64 - (50%) Gaps:6/64 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 VAFVVSELTGGGDISDERLL---APFRRSPEKLEKEMTLLKHNIKY-EEIDMALKELQKPSDLE 682
            :|..||:||  ..:.::..|   |.|.....:..|:|:.|..::|| |:.|..:|..:...||:
Mouse  5487 LATEVSKLT--SQVEEKPSLHGAASFDTPQMRHIKKMSALTSDVKYKEKFDKEMKGKRPQYDLK 5548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d21NP_609129.2 CYP4 68..502 CDD:410721
Cyp51NP_064394.2 CYP51-like 88..499 CDD:410668
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.