DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6c

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:369 Identity:104/369 - (28%)
Similarity:184/369 - (49%) Gaps:22/369 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF----SENKTLVANNYRSLLSD 83
            :||....:| |:..||||....:.||.:.:.|.|..::...|..    |.....|...::.|||:
Mouse    18 KILGEDRSK-NVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSEDGDVHQGFQLLLSE 81

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS-AIVNSWILNRTR 147
            :.:..|...|..|||::..|.:.::..|.....|.::|:.:.:........| ..:|:|:..:|.
Mouse    82 VNKTGTQYSLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELDFKGATEQSRQHINTWVAKKTE 146

  Fly   148 GMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLS 212
            ..|:.::.|...:|:|...||||:||||:|...|..:.|....|.||.||..||:||...::...
Mouse   147 DKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFKVSKNEEKPVQMMFQKSTFKM 211

  Fly   213 GYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSVNVKLPK 270
            .|:::|..||:.|||..:.|:|.|:||:....|..:::::   .||::    .::.:.|.|.||.
Mouse   212 TYVEEISTKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKFIEWTRLDRMKGEKVEVFLPW 276

  Fly   271 FKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVL 334
            ||:|....:|.:...||:.|.|:.. ||.:|:..:.|..:..::.|:.::::|:|.||:|||.::
Mouse   277 FKLEENYDMKDVLCKLGMTDAFEEGRADFSGISSKQGLFLSNVIHKSVVEVNEEGSEATAATTIV 341

  Fly   335 TRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            .:....     ..|. |..:.||.:.|...|.  |.|.|.:..|
Mouse   342 LKGSSR-----STPC-FCVNRPFIFFIQHIKTNEILFLGRLSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 103/364 (28%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 103/367 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.