DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB11

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:401 Identity:111/401 - (27%)
Similarity:205/401 - (51%) Gaps:44/401 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL 72
            |...:||  |..|.::.|.|.|...|:.:|.:|....:|||.:.:.|:|.|:|..||.||.....
Human     4 LSTANVE--FCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDS 66

  Fly    73 VANNYRSL----------------LSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKA 121
            :...::..                .|.:.:.::...|.:|||:|..|......::...:.|.::|
Human    67 LKPGFKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQA 131

  Fly   122 KAKSIRLDDPVSAS-AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQ 185
            :.:::..:.....: ..:|:|:.|:|.|.:.|:......:..:...|||||||||||...|:..:
Human   132 RLQTVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRE 196

  Fly   186 THIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKE 250
            |..:.|.:|..:.:.|:||....:....::.:...:::||||.|:.|||.|:||..:..|:::::
Human   197 TVKSPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEK 261

  Fly   251 KVGFIDYH-------LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGA 307
            ::....:|       :.::.|.|.||:||:|:|.:|..:.::||:.|:| :..|||:|:....|.
Human   262 QLNSGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGL 326

  Fly   308 KIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLI--QPPM--EFIADHPFFYVI---HDNK 365
            .:.|.:.|::|.:.|:|.||:||||         |::.  ..||  :|.|:|||.:.|   |.|.
Human   327 YLSKAIHKSYLDVSEEGTEAAAATG---------DSIAVKSLPMRAQFKANHPFLFFIRHTHTNT 382

  Fly   366 VIYFQGHIVEP 376
            :: |.|.:..|
Human   383 IL-FCGKLASP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 107/387 (28%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 110/399 (28%)
RCL. /evidence=ECO:0000250 341..365 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.