DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB12

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_005266835.2 Gene:SERPINB12 / 89777 HGNCID:14220 Length:437 Species:Homo sapiens


Alignment Length:420 Identity:114/420 - (27%)
Similarity:199/420 - (47%) Gaps:65/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE------------- 68
            |..|.::.:...:..:|:.:||:|....:.||.:.:...:..::..||.|:|             
Human    23 FCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCL 87

  Fly    69 ----------------NKT----------------LVANNYRSLLSDLKRRETFIILHMANRIYV 101
                            .||                ||:..:..|||.|.|.:|...|.:|||:|.
Human    88 KSNKQKVLADSSLEGQKKTTEPLDQQAGSLNNESGLVSCYFGQLLSKLDRIKTDYTLSIANRLYG 152

  Fly   102 NKKYCLVPEFNQLARKAFKAKAKSIRLD-DPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSA 165
            .:::.:..|:.....:.:....:|:... :|..:...:|.|:..:::|.|:.:......|::|..
Human   153 EQEFPICQEYLDGVIQFYHTTIESVDFQKNPEKSRQEINFWVECQSQGKIKELFSKDAINAETVL 217

  Fly   166 FLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNS 230
            .||||:|||.:|...|..:.|..|.|.::|||...|||||.......|:|:::.|:|:|:.|...
Human   218 VLVNAVYFKAKWETYFDHENTVDAPFCLNANENKSVKMMTQKGLYRIGFIEEVKAQILEMRYTKG 282

  Fly   231 TLSMRIILP-NSVDGLRKLKEKVGFIDY----------HLEKKSVNVKLPKFKIESKAQLKGIFE 284
            .|||.::|| :|.|.|:.|:|....|.|          ::.::||.:..|:|.:|....|..|.:
Human   283 KLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLSFPRFTLEDSYDLNSILQ 347

  Fly   285 NLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPP 348
            ::||.|:| :..|||.|:.......:.||:.|.|:::||.|.:|:||||.:...:.     ::..
Human   348 DMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQAAAATGAVVSERS-----LRSW 407

  Fly   349 MEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            :||.|:|||.:.|..||  .|.|.|.:..|
Human   408 VEFNANHPFLFFIRHNKTQTILFYGRVCSP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 113/415 (27%)
SERPINB12XP_005266835.2 ovalbumin_like 16..437 CDD:239014 113/418 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.