DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA6

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:407 Identity:96/407 - (23%)
Similarity:184/407 - (45%) Gaps:67/407 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLYLLLLATSVESGFWE-------------------------DF----YRILASQNAKRNLIYSP 38
            |..||.|.|   ||.|.                         ||    |:.|.:.:.|:|:..||
Human     6 YTCLLWLPT---SGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISP 67

  Fly    39 ISAEIIMSMVYMASGGKTFEELRNVLKFS---ENKTLVANNYRSLLSDLKRRETFIILHMANRIY 100
            :|..:.::|:.:.:.|.|..:|...|.|:   .::|.:...::.|.....:.:|.:.:.|.|.::
Human    68 VSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALF 132

  Fly   101 VNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSA 165
            ::....|:..|:...:..::::..::...|..:||..:||::.|:|:|.|  :.|....:|....
Human   133 LDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKI--VDLFSGLDSPAIL 195

  Fly   166 FLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPY-WN 229
            .|||.|:|||.|...|....|...:|||....::.|.||..|:::...:..::..:::::.| .|
Human   196 VLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGN 260

  Fly   230 STLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKSVN------------VKLPKFKIESKAQLKGI 282
            .|:.  .|||:        |.|:..:...|.:.::|            :.:||..|.....|..:
Human   261 GTVF--FILPD--------KGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDV 315

  Fly   283 FENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQP 347
            .|.:||.|:|...|:.:.:..::..|..|:|.||.|:::|:|.:.:.:|||..       ||...
Human   316 LEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTL-------NLTSK 373

  Fly   348 PMEFIADHPFFYVIHDN 364
            |:....:.||..:|.|:
Human   374 PIILRFNQPFIIMIFDH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 89/393 (23%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 88/368 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.