DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and AT1G64010

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:234 Identity:74/234 - (31%)
Similarity:110/234 - (47%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDD-IDA----KIIELPY--W 228
            :||||.|...|....|...||::       :...::|.||:|.|.|. |:|    |:::||:  .
plant     1 MYFKGAWEEKFHKSMTKDRDFHL-------INGTSVSVSLMSSYKDQYIEAYDGFKVLKLPFRQG 58

  Fly   229 NST---LSMRIILPNSVDGLRKLKEK----VGFIDYHLEKKSVNV---KLPKFKIESKAQLKGIF 283
            |.|   .||...||:..|||..|.||    |||:|.|:..:.|.|   .:||||||........|
plant    59 NDTSRNFSMHFYLPDEKDGLDNLVEKMASSVGFLDSHIPSQKVKVGEFGIPKFKIEFGFSASRAF 123

  Fly   284 ENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVL-------TRRKKSI 341
            ..||:.::                   .:.|||.::|||:|.||.|||.|:       .:|    
plant   124 NRLGLDEM-------------------ALYQKACVEIDEEGAEAIAATAVVGGFGCAFVKR---- 165

  Fly   342 DNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEPRW 378
                   ::|:|||||.::|.::|  .:.|.|.|.:|.:
plant   166 -------IDFVADHPFLFMIREDKTGTVLFVGQIFDPSY 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 72/227 (32%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.