DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and AT1G51330

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_175544.1 Gene:AT1G51330 / 841556 AraportID:AT1G51330 Length:193 Species:Arabidopsis thaliana


Alignment Length:211 Identity:45/211 - (21%)
Similarity:72/211 - (34%) Gaps:79/211 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 AKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTH 187
            |:.:|::        ||||.|..|.|:|:|::.|....:.|.....||:||||.|...|....|.
plant    32 AEEVRME--------VNSWALRHTNGLIKNLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMTI 88

  Fly   188 IADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV 252
            ...|::                        ::.|.:.:|:..|.....:...|....||.|:.:|
plant    89 HKPFHL------------------------VNGKQVLVPFMKSYERKYMKAYNGFKVLRILQYRV 129

  Fly   253 GFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAF 317
            .:.|...:                               |....|||.|:               
plant   130 DYKDTSRQ-------------------------------FSIDMDLNVLI--------------- 148

  Fly   318 LKIDEKGGEASAATGV 333
             :|||:..||:|||.:
plant   149 -EIDEESAEAAAATAL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 45/211 (21%)
AT1G51330NP_175544.1 SERPIN <11..>139 CDD:294093 32/169 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.