DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and AT2G35580

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:411 Identity:105/411 - (25%)
Similarity:184/411 - (44%) Gaps:85/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGF--WEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGG--KTFEELRNVLKFSEN 69
            |..|:|..:  ..|....:.:||.....:.:|: ..:|:|::..:|.|  .|.:::.::|:.|..
plant     3 LEESIEKQYKAMMDLKESVGNQNDIVLRLTAPL-INVILSIIAASSPGDTDTADKIVSLLQASST 66

  Fly    70 KTLVANN---YRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDP 131
            ..|.|.:   ..::|:| ........:..||.:::.|...:.|.|..|...::||...  |:|..
plant    67 DKLHAVSSEIVTTVLAD-STASGGPTISAANGLWIEKTLNVEPSFKDLLLNSYKAAFN--RVDFR 128

  Fly   132 VSASAI---VNSWILNRTRGMIRNIVLPKDFNSD--TSAFLVNAIYFKGQWLYNFKADQTHIADF 191
            ..|..:   ||||:..:|.|:|.|: ||.:..|.  |.....||::|.|:|...|....|..:||
plant   129 TKADEVNREVNSWVEKQTNGLITNL-LPSNPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDF 192

  Fly   192 YVSANEIIPVKMMTLSAS-----LLSGYIDDIDAKIIELPYW-----NSTLSMRIILPNSVDGLR 246
            ::.....:.|..|| .||     :..|:      |:|.|.|.     :.:.||:|.||:..|||.
plant   193 HLLDGTKVRVPFMT-GASCRYTHVYEGF------KVINLQYRRGREDSRSFSMQIYLPDEKDGLP 250

  Fly   247 KLKEKVGFIDYHLEKKSV---------NVKLPKFK----IESKAQLKGIFENLGILDVFKPSADL 298
            .:.|::......|:...|         .:|:|:||    .|:...|||.                
plant   251 SMLERLASTRGFLKDNEVLPSHSAVIKELKIPRFKFDFAFEASEALKGF---------------- 299

  Fly   299 NGLVLESGAKIDKIVQKAFLKIDEKGGEASAAT---GVLTRRKKSIDNLIQPPME---FIADHPF 357
             |||:    .:..|:.|:.:::||.|.:|:||.   |:..||         ||.|   |:|||||
plant   300 -GLVV----PLSMIMHKSCIEVDEVGSKAAAAAAFRGIGCRR---------PPPEKHDFVADHPF 350

  Fly   358 FYVIHDNK--VIYFQGHIVEP 376
            .:::.:.:  ::.|.|.:::|
plant   351 LFIVKEYRSGLVLFLGQVMDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 101/398 (25%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 102/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.