DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina7

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:432 Identity:100/432 - (23%)
Similarity:185/432 - (42%) Gaps:80/432 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLYLLLL---------------------------AT-----SVESGFWEDFYRILASQNAKRNLI 35
            ||:||:|                           ||     |:.:.|....||.|:.:|...|:.
  Rat    14 YLFLLVLGLQATIHCAPHNSSEGKVTTCHLPQQNATLYKMPSINADFAFRLYRKLSVENPDLNIF 78

  Fly    36 YSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLV---ANNYRSLLSDLKRRETFIILHMAN 97
            :||:|....::|:...||..|..::..||.|:...|.|   ...::.|:..|......:.|.|.|
  Rat    79 FSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKELQQGFQHLICSLNFPNNELELQMGN 143

  Fly    98 RIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSD 162
            .:::.::...:.:|....:..::.:..|....:..:|...:||::..:|:|.|..::  :|...:
  Rat   144 AVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEINSYVEKQTKGKIVGLI--QDLKLN 206

  Fly   163 TSAFLVNAIYFKGQWLYNFKADQT-HIADFYVSANEIIPVKMMTLSASLLSGYID-DIDAKIIEL 225
            ....|||.|:||.||...|:..:| ..::|.|..:..:.|.||. .......|:| :::..::::
  Rat   207 IIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVPMMH-QLEQYYHYVDVELNCTVLQM 270

  Fly   226 PYWNSTLSMRIILPNSVDGLRKLKEKVGFIDY--------------HLEKKS-VNVKLPKFKIES 275
            .|..:.|:: .:||           |.|.:::              ||.:|. |.:.:|||.|.:
  Rat   271 DYSANALAL-FVLP-----------KEGHMEWVEAAMSSKTLKKWNHLLQKGWVELFVPKFSISA 323

  Fly   276 KAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGE--ASAATGVLTRRK 338
            ...|....:.:|:.|.|..|||..|:..::|.|:.....||.|.|.|:|.:  ||...|      
  Rat   324 TYDLGSTLQKMGMRDAFAESADFPGITKDNGLKLSYAFHKAVLHIGEEGTKEGASPEAG------ 382

  Fly   339 KSIDNLIQPPMEFI--ADHPFFYVIHDNKV--IYFQGHIVEP 376
             |:|.....|:..:  .|..|..:|.:.:.  :.|.|.:|:|
  Rat   383 -SLDQPEVAPLHAVIRLDRTFLLMILEKRTRSVLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/381 (24%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 95/398 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.