DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpind1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:375 Identity:97/375 - (25%)
Similarity:186/375 - (49%) Gaps:32/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQ-NAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE--------NKTLVAN 75
            :.||:|..| .:..|:..:|:.....|.|:.:...|:|.||:.:||.|.:        ..|.:.|
  Rat   116 NLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDFVNASSKYEVTTIHN 180

  Fly    76 NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNS 140
            .:|.|...|.||.....|...|.:|:.|::.:..:|....|:.:.|:|:.....||...|. .||
  Rat   181 LFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPAFISK-ANS 244

  Fly   141 WILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMT 205
            .||..|:|:|:..:  ::.:|.|...::|.|||||.|:..|..:.||..:|.::..|::.|.||.
  Rat   245 HILKLTKGLIKEAL--ENTDSATQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREVVKVSMMQ 307

  Fly   206 LSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV-GFIDYHLEKKSVN---- 265
            ...:.|:....::|..|::|.|... :||.|::|..:.|::.|:.:: ..:....:|...|    
  Rat   308 TKGNFLAANDQELDCDILQLEYVGG-ISMLIVIPRKLSGMKTLEAQLTPQVVERWQKSMTNRTRE 371

  Fly   266 VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAA 330
            |.|||||:|....|..:.:::||..:|..:.:::| :.:....||....::.:.::|:|.:|:|.
  Rat   372 VLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSG-ISDQRIIIDLFKHQSTITVNEEGTQAAAV 435

  Fly   331 T--GVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            |  |.:.         :...:.|..|.||.:::::::.  :.|.|.:..|
  Rat   436 TTVGFMP---------LSTQVRFTVDRPFLFLVYEHRTSCLLFMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/370 (26%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 97/375 (26%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.