DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina9

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:376 Identity:98/376 - (26%)
Similarity:169/376 - (44%) Gaps:37/376 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVAN-----NYRSLL 81
            |:.||.:|..:|:::||:|....::|:.:.:...|..::...|.|  |.|.|:.     .:..|:
Mouse    58 YQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGF--NFTWVSEPTIHMGFEYLV 120

  Fly    82 SDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRT 146
            ..|.:......|.|.:.:::.|:..|...|....:|.:.||..|....:..:|.|.:||::...|
Mouse   121 RSLNKCHQGRELRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNAATAQAQINSYVEKET 185

  Fly   147 RGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIA-DFYVSANEIIPVKMMTLSASL 210
            :|.:.:::  :|.:|.|:..|||.|:||..|...|....|:.: .|.:|....:.|.||..:.|.
Mouse   186 KGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVPMMHQTESF 248

  Fly   211 LSGYIDDIDAKIIELPYWNSTLSMRIILPN-----------SVDGLRKLKEKVGFIDYHLEKKSV 264
            ..|...::...|:::.|....::. .:||.           |...|||....       |:|:.:
Mouse   249 AFGVDKELGCSILQMDYRGDAVAF-FVLPGKGKMRQLEKSLSARRLRKWSRS-------LQKRWI 305

  Fly   265 NVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASA 329
            .|.:|||.|.:...|:.|...:||.|.|..:||.:|:......::.|...||.|.:.|:|.||:|
Mouse   306 KVFIPKFSISASYNLETILPKMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLDVSEEGTEAAA 370

  Fly   330 ATGVLTRRKKSIDNLIQPPMEFIA-DHPFFYVIHDNKV--IYFQGHIVEPR 377
            ||     ..|.|......|...|| ..||..::.|...  :.|.|.:..||
Mouse   371 AT-----TTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFLGKVENPR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/370 (26%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 96/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.