DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb12

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:424 Identity:114/424 - (26%)
Similarity:205/424 - (48%) Gaps:63/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF--------- 66
            |:..:.|..||:|.::..:|.:|:...|:|......||.:.:.|.:..::...|.|         
Mouse     5 TAANNKFCFDFFREISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAHQIDEALHFNELSKDEHK 69

  Fly    67 --------SENKT--------------------------LVANNYRSLLSDLKRRETFIILHMAN 97
                    ||:|.                          |:..::..|||.:.|.:::..|.|||
Mouse    70 EPNDPSPQSESKASDSSLEGQKQTSASQDQQGESTNDHQLLGCHFGKLLSRIDRDKSYYTLSMAN 134

  Fly    98 RIYVNKKYCLVPEFNQLARKAFKAKAKSIRLD-DPVSASAIVNSWILNRTRGMIRNIVLPKDFNS 161
            |:|..:::.:..|::....:.|....:|:... |...:...:|.|:.::::|.|:.:...:..::
Mouse   135 RLYGEQEFPICSEYSDDVTEFFHTTVESVDFQKDSEKSRQEINFWVESQSQGKIKELFGKEAIDN 199

  Fly   162 DTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELP 226
            .|...||||:|||.:|...|.::.|..|.|.::.||...||||........|:||::.|:|:|:.
Mouse   200 STVLVLVNAVYFKAKWEREFNSENTVDASFCLNENEKKTVKMMNQKGKFRIGFIDELQAQILEMK 264

  Fly   227 YWNSTLSMRIILP----NSVDGLRKLKEKVGF-------IDYHLEKKSVNVKLPKFKIESKAQLK 280
            |....|||.::||    ::|:.|::|::|:..       ...:|.:|.|.:..|:|.:|....||
Mouse   265 YAMGKLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFPQFNLEDSYDLK 329

  Fly   281 GIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNL 344
            .|.:::||.||| :..|||.|:.......:.|||.|.|:::||.|.:|:||:||:...|     .
Mouse   330 SILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQAAAASGVVAAEK-----A 389

  Fly   345 IQPPMEFIADHPFFYVIHDN--KVIYFQGHIVEP 376
            :...:||.|:|||.:.|..|  :.:.|.|.:..|
Mouse   390 LPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 112/413 (27%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 113/422 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106 3/42 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.