DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPING1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_000053.2 Gene:SERPING1 / 710 HGNCID:1228 Length:500 Species:Homo sapiens


Alignment Length:392 Identity:86/392 - (21%)
Similarity:163/392 - (41%) Gaps:81/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLS--- 82
            ::...|.:..:.|:.:||.|...:::.|.:.:|..|...|.::|.:.::.|.|....:...:   
Human   154 YHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGV 218

  Fly    83 ----------DLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAI 137
                      ||..|:||:                     ..:|..:.:..:.:..:...:.. :
Human   219 TSVSQIFHSPDLAIRDTFV---------------------NASRTLYSSSPRVLSNNSDANLE-L 261

  Fly   138 VNSWILNRTRGMIRNIV--LPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIP 200
            :|:|:...|...|..::  ||    |||...|:||||...:|...|...:|.:..|:.. |.:|.
Human   262 INTWVAKNTNNKISRLLDSLP----SDTRLVLLNAIYLSAKWKTTFDPKKTRMEPFHFK-NSVIK 321

  Fly   201 VKMMTLSASLLSGYIDD-IDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHL----- 259
            |.||......::.:||. :.||:.:|.. :..||:.|::|      :.||.::..::..|     
Human   322 VPMMNSKKYPVAHFIDQTLKAKVGQLQL-SHNLSLVILVP------QNLKHRLEDMEQALSPSVF 379

  Fly   260 ----EKKSVN------VKLPKFKIESKAQLKGIFENLGILDVFKPSADLN--GLVLESGAKIDKI 312
                ||..::      :.||:.|:.:...:..|.|.|...|.   |.|||  ||..:...::..:
Human   380 KAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDF---SYDLNLCGLTEDPDLQVSAM 441

  Fly   313 VQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHD--NKVIYFQGHIVE 375
            ..:..|::.|.|.||:||:.:...|...:         |....||.:|:.|  :|...|.|.:.:
Human   442 QHQTVLELTETGVEAAAASAISVARTLLV---------FEVQQPFLFVLWDQQHKFPVFMGRVYD 497

  Fly   376 PR 377
            ||
Human   498 PR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 84/386 (22%)
SERPING1NP_000053.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..118
7 X 4 AA tandem repeats of [QE]-P-T-[TQ] 85..119
C1_inh 145..495 CDD:239005 84/386 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.