DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA7

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:437 Identity:94/437 - (21%)
Similarity:179/437 - (40%) Gaps:81/437 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLYLLLLA-------------------------------TSVESGFWEDFYRILASQNAKRNLIY 36
            :|||:||.                               :|:.:.|..:.||....:...:|:.:
Human     4 FLYLVLLVLGLHATIHCASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFF 68

  Fly    37 SPISAEIIMSMVYMASGGKTFEELRNVLKFSENKT---LVANNYRSLLSDLKRRETFIILHMANR 98
            ||:|....:.|:...:...|..|:...|.|:...|   .:.:.::.|:..|...:..:.|.:.|.
Human    69 SPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLNFPKKELELQIGNA 133

  Fly    99 IYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDT 163
            :::.|....:.:|....:..::.:..|....:..:|...:||.:..:|:|.:..::  :|...:|
Human   134 LFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLI--QDLKPNT 196

  Fly   164 SAFLVNAIYFKGQWLYNFKADQTH-IADFYVSANEIIPVKMMTLSASLLSGY---ID-DIDAKII 223
            ...|||.|:||.||...|...:|. .:.|.:.....:.|.||    ..:..|   :| :::..::
Human   197 IMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMM----HQMEQYYHLVDMELNCTVL 257

  Fly   224 ELPYWNSTLSMRIILP-----NSVDGLRKLK--EKVGFIDYHLEKKSVNVKLPKFKIESKAQLKG 281
            ::.|..:.|:: .:||     .||:.....|  :|...:   |:|..|::.:|||.|.:...|..
Human   258 QMDYSKNALAL-FVLPKEGQMESVEAAMSSKTLKKWNRL---LQKGWVDLFVPKFSISATYDLGA 318

  Fly   282 IFENLGILDVFKPSADLNGLVLESGAKID----------KIVQKAFLKIDEKGGEASAATGVLTR 336
            ....:||...:..:||.:||..::|.|:.          :...||.|.|.|||.||:|.      
Human   319 TLLKMGIQHAYSENADFSGLTEDNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTEAAAV------ 377

  Fly   337 RKKSIDNLIQPPMEFI-----ADHPFFYVI--HDNKVIYFQGHIVEP 376
              ..::...||...|:     .|..|..:|  ...:.|.|.|.:|.|
Human   378 --PEVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVVNP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 86/387 (22%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 86/390 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.