DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina5

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:381 Identity:107/381 - (28%)
Similarity:189/381 - (49%) Gaps:26/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS---ENK 70
            :.||....|....||.|||:...:|:.:||:|..:.:.|:.:.||.||..::...|..|   ..:
  Rat    75 VGTSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQGQE 139

  Fly    71 TLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS 135
            .::...::.||....:....:.|.:.:.::.:....:...|....:..:.:...|....:|.||.
  Rat   140 DMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFGNPESAK 204

  Fly   136 AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIP 200
            ..:|.::..:|.|.|.:::  ||.:|.....:||.|:||.:|...|.:..||..|::|:..:.|.
  Rat   205 KQINDYVAKKTNGKIVDLI--KDLDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTIQ 267

  Fly   201 VKMMTLSASLLSGYID-DIDAKIIELPYWNSTLSMRIILPNS------VDGL--RKLKEKVGFID 256
            |.||. ...:.|..:| :|...::.:||..:|.:: .|||:.      .|||  |.|:..:..  
  Rat   268 VPMMN-REDIYSYILDQNISCTVVGIPYQGNTFAL-FILPSEGKMKRVEDGLDERTLRNWLKM-- 328

  Fly   257 YHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKID 321
              ..|:.:::.||||.||...:|:.|...|||.|:|...|||:||...:..|:.::|.|:.:::|
  Rat   329 --FTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSGLTDHTNIKLSEMVHKSMVEVD 391

  Fly   322 EKGGEASAATGVL-TRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVEP 376
            |.|..|:|:||:| |.|.....:|   .:||  ..||..||.|...:||.|.:::|
  Rat   392 ESGTTAAASTGILFTLRSARPSSL---KVEF--TRPFLVVIMDGTNLYFIGKVIQP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/368 (28%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 104/370 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.