DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB3

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens


Alignment Length:380 Identity:112/380 - (29%)
Similarity:198/380 - (52%) Gaps:41/380 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF---SENKT------------LVANNY 77
            ::.:.|:.|||||....:.||.:.:...|.::::.||.|   :||.|            .|.:.:
Human    21 KSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQF 85

  Fly    78 RSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL-DDPVSASAIVNSW 141
            :.||::..:......|.:||:::..|.|..:.|:....:|.::...:|:.. :.|..:...:|||
Human    86 QKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSW 150

  Fly   142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTL 206
            :.::|...|:|::...:..|:|:..|||||||||||...|..:.|....|:.:.|....::||..
Human   151 VESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQ 215

  Fly   207 SASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSV 264
            ..|.....::|:.||::|:||....|||.::|||.:|||:||:||:   ..:::    ::.:..|
Human   216 YTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV 280

  Fly   265 NVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASA 329
            ::.||:||:|....||.....:|::|:|...|||:|:....|..:..::.|||:::.|:|.||:|
Human   281 DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAA 345

  Fly   330 ATGVL------TRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            ||.|:      |...:          ||..:|||.:.|..||.  |.|.|....|
Human   346 ATAVVGFGSSPTSTNE----------EFHCNHPFLFFIRQNKTNSILFYGRFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 111/375 (30%)
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 111/378 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.