DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and LOC569077

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:379 Identity:122/379 - (32%)
Similarity:199/379 - (52%) Gaps:31/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDL 84
            |.|:.|::.:|:.|:.:||:|...::||||:.:.|.|..|:..||..| :.:.|.:::.||:|.:
Zfish    14 DLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLS-SVSDVHSHFESLISSI 77

  Fly    85 KRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS----AIVNSWILNR 145
            .......||.:|||:|..|.:..:||......|.:.|:.:::   |.:.||    .::|.|:..:
Zfish    78 NSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTV---DFIGASEGSRQLINKWVEKQ 139

  Fly   146 TRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASL 210
            |...||:::.|....:.|...|||||||||:|.:.|:|..|....|.::..|..||:||.....|
Zfish   140 TENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPVRMMHQLNKL 204

  Fly   211 LSGYIDDIDAKIIELPYWNSTLSMRIILPNSV----DGLRKLKEKV---GFIDYHLEKK-----S 263
            ....:.:...:::||||....|||.|:||:..    |.|.||::::   ..:|:....|     :
Zfish   205 PFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKELTLEKLLDWTNRDKMDTQGA 269

  Fly   264 VNVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEA 327
            |.|.|||||:|.::.|....|.:|:..||:.: |||.|:....|..:..::.|||:.:.|:|.||
Zfish   270 VIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMGSNGGLFVSAVIHKAFVDVSEEGTEA 334

  Fly   328 SAATGVLTRRKKSIDNLI---QPPMEFIADHPFFYVIHDN--KVIYFQGHIVEP 376
            :|||.|..     |.:.:   :|...|.|||||.:.|..|  ..|.|.|....|
Zfish   335 AAATCVYI-----ITSYVPRPEPRYYFTADHPFMFFIRHNPSNNILFLGRYRSP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 121/374 (32%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 121/377 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.