DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinb14

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002665111.3 Gene:serpinb14 / 569051 ZFINID:ZDB-GENE-050506-148 Length:437 Species:Danio rerio


Alignment Length:438 Identity:113/438 - (25%)
Similarity:210/438 - (47%) Gaps:77/438 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS-------- 67
            ::..:.|..:.::.::..||..|:.|||:|....::||.:.:.|.|.:::..||.|:        
Zfish     5 SAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNLPKSAGA 69

  Fly    68 -------------------------------------------------ENKTLVANNYRSLLSD 83
                                                             :.:..:.:|:...:|:
Zfish    70 TPEAHQSMMQQAQKPKSGVKDQHGQAMMQQTQKIDIPAELKKGSAVPGQKAEEQIHSNFNKFMSE 134

  Fly    84 LKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAI-VNSWILNRTR 147
            |.:.....:|.:|||:|..:.|..|.:|...|::.::|..:.:...:...|:.: :|:|:...|:
Zfish   135 LNKPGAPYVLSLANRLYGEQTYQFVEKFLSDAKRYYEAGLEKVDFKNKSEAARVNINTWVEKNTQ 199

  Fly   148 GMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLS 212
            ..|::::.....::.|...|||||||||.|...|..:.|:...|.::.|:..|||||...|....
Zfish   200 EKIKDLLPSGAIDAMTRLVLVNAIYFKGNWERKFPKEATNDGQFKLNKNQTKPVKMMYQKAHFPL 264

  Fly   213 GYIDDIDAKIIELPYWNSTLSMRIILPNSVD----GLRKLKEKVGF---IDYH----LEKKSVNV 266
            ..|.:::::::||||....|||.||||:.::    ||.||::.:.:   :::.    :.::.|.|
Zfish   265 ASIPEMNSQVLELPYVGKNLSMLIILPDQIEDATTGLEKLEKALTYEKLMEWTKPEVMRQQEVQV 329

  Fly   267 KLPKFKIESKAQLKGIFENLGILDVFKP-SADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAA 330
            .|||||:|....:|.:..::|:.|||.| ..:|.|:...:...:.|::.|||::::|:|.||:||
Zfish   330 SLPKFKMEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTEAAAA 394

  Fly   331 TGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN--KVIYFQGHIVEP 376
            ||.:...:     .|:.|..|.|||||.:.|..|  |.|.|.|....|
Zfish   395 TGAIMMLR-----CIRLPQSFNADHPFLFFIRHNPTKSILFYGRFCSP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 112/427 (26%)
serpinb14XP_002665111.3 SERPIN 4..437 CDD:294093 112/436 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3432
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.