DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinf2a

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_688797.1 Gene:serpinf2a / 560308 ZFINID:ZDB-GENE-060822-1 Length:457 Species:Danio rerio


Alignment Length:359 Identity:98/359 - (27%)
Similarity:169/359 - (47%) Gaps:48/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLKRRETFIILHMAN 97
            |:|.||:|..:.::.:.:.:...|.|:|..||...|     ..::...||.|:...|...:.||:
Zfish    66 NIIISPLSVSLALAELALGARNNTEEKLLEVLHAKE-----LPHFHETLSCLQEHLTAKAVKMAS 125

  Fly    98 RIYVNKKYCLVPEFNQLARKAFKAK-AKSIRLDDPVSASAIVNSWILNRTRGMIRNIV--LPKDF 159
            |:|:...|.:.|:|...|...:|:: |:...::|       ||.|:...|.|.|.|.:  ||   
Zfish   126 RLYLVPGYTVNPDFVDRALNLYKSESAQLTSIED-------VNRWVEETTNGQITNFMSSLP--- 180

  Fly   160 NSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDID-AKII 223
             .:....|:|||:|||:|...|.:..|....|::.....:.|.||..|...||.::|..| .::.
Zfish   181 -PNVVLMLINAIHFKGEWQSRFNSKYTKENIFHIDRKTSVKVDMMMGSQYPLSMFVDRTDGTQVA 244

  Fly   224 ELPYWNSTLSMRIILPN-SVDGLRKLKEKVGFIDYHL---EKKSVNVKLPKFKIESKAQLKGIFE 284
            .||: ...:|:.:|:|. ..:.|..:..|:...|.:.   .::|::|.|||||:|.|..|:....
Zfish   245 RLPF-RGNMSLLVIMPRLQHENLSNVAAKLNISDMYARFPRERSMHVTLPKFKLEYKQDLRQALT 308

  Fly   285 NLGILDVFKPSADLN----GLVLESGAKIDKIVQKAF-LKIDEKGGEASAATGVLTRRKKSIDNL 344
            ::|:..:| ...||:    |.::.||      ||.|. :::.|:|.||||||..         .|
Zfish   309 SMGLGFLF-TGPDLSRIAPGPLVVSG------VQHASNMELSEEGAEASAATSF---------TL 357

  Fly   345 IQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            ::....|..:.||.:.:.|:.  ...|.|.:..|
Zfish   358 VRTISFFSVNMPFIFALVDDTSYTPLFLGIVTNP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 97/354 (27%)
serpinf2aXP_688797.1 SERPIN 54..388 CDD:294093 97/354 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.