DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpine3

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001116709.1 Gene:serpine3 / 556612 ZFINID:ZDB-GENE-050309-223 Length:417 Species:Danio rerio


Alignment Length:406 Identity:102/406 - (25%)
Similarity:175/406 - (43%) Gaps:51/406 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWED--------FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLK 65
            :|.||.|..:.|        .|:.|.....|.|||.||.|..:.:.::.:.:.|.|..:|...|.
Zfish    21 VANSVLSSSFSDLHTQFGISLYQTLTETENKSNLIVSPASVSLCLGLLQLGARGNTLVQLEGTLG 85

  Fly    66 FSENKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD 130
            :..|...|.|.......||......:.|.:||.:::.....|:|||.|.|.........|:...:
Zfish    86 YDVNDVRVQNILSRPQGDLANSSEGLRLQLANALFIQTGVKLLPEFTQHALGWGNTSLLSVNFSN 150

  Fly   131 PVSASAIVNSWI---------------LNRTRGMIRNIVLPKDFNSDTSAF--LVNAIYFKGQWL 178
            |....:.:..|.               |:.:.|......     ..|...:  ||:.:.|.|.|.
Zfish   151 PNHTHSRLQQWAHYQSKADDHLQTREELHHSSGEEEEAT-----RQDHLLYMALVSTLVFHGAWQ 210

  Fly   179 YNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYI---DDIDAKIIELPYWNSTLSMRIILPN 240
            ..|...:|....|..|....:.|.||..|:.:..|:.   .:.:..::||||.:.:|.:.:.||:
Zfish   211 KQFLFTETQNLPFTFSDGSTVKVPMMYQSSEVNIGHFRLPSEQEYTVLELPYLDHSLRLLVALPS 275

  Fly   241 S-VDGLRKLKEK-----VGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADL 298
            . ...|.:|:::     ||..|..|.:..:::.||:||::||..||.:.::||:.|:|.|| ||.
Zfish   276 DRKTPLSQLEKQITARAVGLWDTGLRRTKMDIFLPRFKMQSKINLKPVLQSLGVSDIFSPSAADF 340

  Fly   299 NGLVLESGAKIDKIVQKAFLKIDEKGGEASAATG-VLTRRKKSIDNLIQPPMEFIADHPFFYVIH 362
            .|:....|..:.:...:|.:::.|.|.:|::||. ||.:|.:|        ..|.||.||.:::.
Zfish   341 RGISDTDGIFVSEAFHEARIEVTEAGTKAASATAMVLLKRSRS--------AVFKADRPFLFILR 397

  Fly   363 DNKV--IYFQGHIVEP 376
            ....  :.|.|.:|.|
Zfish   398 QISTGSLLFIGRVVNP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 96/393 (24%)
serpine3NP_001116709.1 Serpin 35..413 CDD:278507 96/390 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.