DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpind1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001015716.1 Gene:serpind1 / 548433 XenbaseID:XB-GENE-6085731 Length:484 Species:Xenopus tropicalis


Alignment Length:386 Identity:95/386 - (24%)
Similarity:184/386 - (47%) Gaps:41/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VESGFWEDFYRILASQ-NAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF-------SEN 69
            :.:.|..:.||.:.:. :|..|::.:|:.....|:.:.:.:.|:..:::...|.|       |:.
 Frog   115 INANFGFNLYRAIKNNTDASDNILLAPVGISTAMATISLGTKGQALDQVLFTLGFKNFINASSKY 179

  Fly    70 KTLVANN-YRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVS 133
            :.|..:| :|.|...|.||.....|...|.|||.|.:.:...|....:..:.|:|:.:   |..|
 Frog   180 EILTLHNVFRKLTHRLFRRNFGYTLRSVNDIYVKKDFVIREPFKNNLKNYYFAEAQMV---DFGS 241

  Fly   134 ASAI--VNSWILNRTRGMIRNIVLPKDFNSDTS--AFLVNAIYFKGQWLYNFKADQTHIADFYVS 194
            ...:  .|..|...|:|:|:..:.    |.|.:  ..|||.|||||.|...|..:.|...:|.::
 Frog   242 KDFLTKANKRIQQLTKGLIKEALT----NVDPALLMLLVNCIYFKGTWENKFPVEYTQNMNFRLN 302

  Fly   195 ANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVG--FIDY 257
            ..|::.|.||....:.|.....::|..:::|||..: :||.|:||:.:.|::.|::::.  .::.
 Frog   303 EKELVKVPMMKTKGNFLVAADPELDCAVLQLPYVGN-ISMLIVLPHKLSGMKLLEKQISPQVVER 366

  Fly   258 H---LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLK 319
            .   :..::..|.||:||:|....|:.:..|:|:.|:| ...|.:| |.:....|.....:..:.
 Frog   367 WQNIMTNRTREVFLPRFKLEKSYNLQEVLSNMGVTDLF-THGDFSG-VSDKNMNIGLFQHQGTIT 429

  Fly   320 IDEKGGEASAAT--GVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            ::|:|.||:|.|  |.:.         :.....|:||.||.::|::::.  :.|.|.:..|
 Frog   430 VNEEGTEAAAVTVVGFMP---------LSTQARFVADRPFLFLIYEHRTNCLIFMGRVANP 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 94/377 (25%)
serpind1NP_001015716.1 serpinD1_HCF2 38..484 CDD:381004 95/386 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.