DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINI2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001012303.2 Gene:SERPINI2 / 5276 HGNCID:8945 Length:405 Species:Homo sapiens


Alignment Length:397 Identity:105/397 - (26%)
Similarity:202/397 - (50%) Gaps:32/397 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLYLLLL----------ATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTF 57
            :|:.|||          :....:.|..|.|:.: |.:.|.|:|:||:...:::.||.:.:.||..
Human     5 FLWSLLLLFFGSQASRCSAQKNTEFAVDLYQEV-SLSHKDNIIFSPLGITLVLEMVQLGAKGKAQ 68

  Fly    58 EELRNVLKFSENKT----LVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKA 118
            :::|..||..|...    .|..::.|.:|:.|:..||   ::||.:|:.:.:.:..::....::.
Human    69 QQIRQTLKQQETSAGEEFFVLKSFFSAISEKKQEFTF---NLANALYLQEGFTVKEQYLHGNKEF 130

  Fly   119 FKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKA 183
            |::..|.:...|..:.:.::::|:..:|.|.|:::...::|...|...|||||||||.|...|:.
Human   131 FQSAIKLVDFQDAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRK 195

  Fly   184 DQTHIADFYVSANEIIPVKMMTLSASLLSGYIDD--IDAKIIELPYWNSTLSMRIILP---NSVD 243
            :.|.:.:|.......:.:.||........||..:  ::.:::||.|.....|:.||||   ..::
Human   196 EDTQLINFTKKNGSTVKIPMMKALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMDIE 260

  Fly   244 GLRKLKEKVGFIDY--HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESG 306
            .:.||......:.:  .::::.|.:.||:||:|.|...|.:..:|.|.::|....||:|:...|.
Human   261 EVEKLITAQQILKWLSEMQEEEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSE 325

  Fly   307 AKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN--KVIYF 369
            ..:.::.||.|.:|:|.|.||:.:||:   ....|.:|.|  .:|||:|||.:::..|  :.|.|
Human   326 VYVSQVTQKVFFEINEDGSEAATSTGI---HIPVIMSLAQ--SQFIANHPFLFIMKHNPTESILF 385

  Fly   370 QGHIVEP 376
            .|.:..|
Human   386 MGRVTNP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 100/368 (27%)
SERPINI2NP_001012303.2 serpinI2_pancpin 23..392 CDD:381042 100/377 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.