DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB13

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:408 Identity:113/408 - (27%)
Similarity:200/408 - (49%) Gaps:54/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVL---------- 64
            |.|...||  |.::.|...| ..|:.:||:.....:.||.:.:.|.|..:|..|.          
Human     6 AVSTRLGF--DLFKELKKTN-DGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSR 67

  Fly    65 ---------------KFSENKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQL 114
                           |..||...|...::..|:::.:......|::.||::..|.|..:.::...
Human    68 IKAEEKEVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDY 132

  Fly   115 ARKAFKAKAKSIRLDDPVSAS----AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKG 175
            ..|.:.|..:.:   |.|:|:    ..:|||:.::|...|:::......:|.|...|||.:||||
Human   133 VEKYYHASLEPV---DFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKG 194

  Fly   176 QWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPN 240
            ||...||.:.|....|:::.:....|:|||.|.|....:::|:.|||:.:||.|:.|||.::|||
Human   195 QWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPN 259

  Fly   241 SVDGLRKLKEKVG---FIDY----HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVF-KPSAD 297
            .:|||.|:.:|:.   .:::    |:|::.||:.||:|::|....|:.:...:|:.|.| :..||
Human   260 DIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKAD 324

  Fly   298 LNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFI-ADHPF-FYV 360
            .:|:...||....|.:..:|:.:.|:|.||:||||:      .......|..|.: .:||| |::
Human   325 YSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGI------GFTVTSAPGHENVHCNHPFLFFI 383

  Fly   361 IHD--NKVIYFQGHIVEP 376
            .|:  |.:::| |....|
Human   384 RHNESNSILFF-GRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 109/396 (28%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 112/406 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.