DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINI1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001116224.1 Gene:SERPINI1 / 5274 HGNCID:8943 Length:410 Species:Homo sapiens


Alignment Length:397 Identity:104/397 - (26%)
Similarity:200/397 - (50%) Gaps:29/397 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LYLLLLATSVESG--FWED--------FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFE 58
            |:.||:..|:.:|  |.|:        .|..|.:.....|:::||:|..:.|.|:.:.:.|.|.:
Human     6 LFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQK 70

  Fly    59 ELRNVLKFSENKTLVANNYRSLLSDL-KRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAK 122
            |:|:.:.:...|.....::....|:: ..:|:..::.:||.::|...:.:..||.|:.:|.|.|.
Human    71 EIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAA 135

  Fly   123 AKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTH 187
            ...:.....|:.:..:|.|:.|.|..:::::|.|:||::.|...|:||:||||.|...|:.:.|.
Human   136 VNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTR 200

  Fly   188 IADFYVSANEIIPVKMMTLSASLLSGYIDDID------AKIIELPYWNSTLSMRIILPNSVDGLR 246
            ...|.......:.:.||........|...|..      .:::|:||....:||.::|......|.
Human   201 TFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLA 265

  Fly   247 KLKE--KVGFID---YHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESG 306
            .|:.  |...::   ..::|:.|.|.||:|.:|.:..||.:.:.|||.::|...|:|.||.....
Human   266 TLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKE 330

  Fly   307 AKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYF 369
            ..:.|.:.|:||:::|:|.||:|.:|::...:.::   :.|  :.|.|||||::|.:.:  .|.|
Human   331 IFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAV---LYP--QVIVDHPFFFLIRNRRTGTILF 390

  Fly   370 QGHIVEP 376
            .|.::.|
Human   391 MGRVMHP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 98/377 (26%)
SERPINI1NP_001116224.1 neuroserpin 23..410 CDD:239003 98/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.