DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB10

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_005015.1 Gene:SERPINB10 / 5273 HGNCID:8942 Length:397 Species:Homo sapiens


Alignment Length:404 Identity:114/404 - (28%)
Similarity:196/404 - (48%) Gaps:46/404 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS------ 67
            ||||:.. |..:..:.||.....:|:.:|..|....:::||:.:.|.|..::..||:|:      
Human     4 LATSINQ-FALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVK 67

  Fly    68 ---------------ENKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARK 117
                           .|...:.:::::|:|::.:.....:|..||.||..|.|....::.:..:.
Human    68 CDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKT 132

  Fly   118 AFKAKAKSIRLDDPVSAS----AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWL 178
            .|.|:.:.:..   |.||    ..:|||:..:|.|.|:|::.....:|.|...||||:||||.|.
Human   133 YFGAEPQPVNF---VEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWE 194

  Fly   179 YNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVD 243
            :.|....|....|.::.....||:||.:...|...:|:...|..::|.|.:..||:.|:||..::
Human   195 HQFLVQNTTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDIN 259

  Fly   244 GLRKLKEKVGFIDYH-------LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNG 300
            ||.:|::.:.:...:       :|...|.:.|||||:|....||....::|:.|.|..| ||.:|
Human   260 GLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSG 324

  Fly   301 LVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQ-PPMEFIADHPFFYVIHDN 364
            :.......:..:..|||::|:|:|.||:|.:|      ..||..|: |.:||.|:|||.:.|..|
Human   325 MSSARNLFLSNVFHKAFVEINEQGTEAAAGSG------SEIDIRIRVPSIEFNANHPFLFFIRHN 383

  Fly   365 K--VIYFQGHIVEP 376
            |  .|.|.|.:..|
Human   384 KTNTILFYGRLCSP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 109/391 (28%)
SERPINB10NP_005015.1 PAI-2 4..397 CDD:239013 113/402 (28%)
Nuclear localization signal 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.