DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINB8

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:367 Identity:109/367 - (29%)
Similarity:188/367 - (51%) Gaps:20/367 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLKR 86
            ::||..::..||:.:||:|....::||:|.:.|.|..::...|...::.. :...::||||::.|
Human    16 FKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGD-IHRGFQSLLSEVNR 79

  Fly    87 RETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL-DDPVSASAIVNSWILNRTRGMI 150
            ..|..:|..|||::..|....:|:|.:..:|.::|:.:.:.. :|.......:|.|:..:|.|.|
Human    80 TGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKI 144

  Fly   151 RNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSAN-EIIPVKMMTLSASLLSGY 214
            ..::.....:..|...|||||||||:|  |.:.|:.:........| |...|:||...|....||
Human   145 SEVLDAGTVDPLTKLVLVNAIYFKGKW--NEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGY 207

  Fly   215 IDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDY-------HLEKKSVNVKLPKFK 272
            .|::..:::||||....|||.|:||:....|..:::.:.:..:       .|.|..|.|.||:.|
Human   208 ADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLK 272

  Fly   273 IESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTR 336
            :|....|:.....||::|.| :..||.:|:..|....:.|:..|.|::::|:|.||:|||.|:  
Human   273 LEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVV-- 335

  Fly   337 RKKSIDNLIQPPMEFIADHPFFYVI--HDNKVIYFQGHIVEP 376
             :.|..:.::|  .|.|||||.:.|  |....|.|.|....|
Human   336 -RNSRCSRMEP--RFCADHPFLFFIRHHKTNCILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 108/362 (30%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 108/365 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.