DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINE2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_005246698.1 Gene:SERPINE2 / 5270 HGNCID:8951 Length:410 Species:Homo sapiens


Alignment Length:368 Identity:104/368 - (28%)
Similarity:176/368 - (47%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSEN---KTLVANNYRSLLSDLKRRETFIILH 94
            |::.||.....::.|:.:.:.|:|.::|..|:::..|   |.|...| ::::|. |.::   |:.
Human    62 NIVISPHGIASVLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKIN-KAIVSK-KNKD---IVT 121

  Fly    95 MANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDF 159
            :||.::|.....:...|....:..|:.:.:::..:||.||...:|:|:.|.||.||.|::.|...
Human   122 VANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLI 186

  Fly   160 NSD-TSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYI---DDIDA 220
            :.. |...||||:||||.|...|:.:.|....|..:..:...|.|:...:....|..   :|:..
Human   187 DGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWY 251

  Fly   221 KIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKS------------VNVKLPKFKI 273
            ..|||||...::||.|.||.      :....:..|..|:..|:            |.|.||||..
Human   252 NFIELPYHGESISMLIALPT------ESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTA 310

  Fly   274 ESKAQLKGIFENLGILDVFKPSADLNGLVLESGAK---IDKIVQKAFLKIDEKGGEASAATGVLT 335
            .::..||...:.|||.|:| .|:..|...:.:|::   :..|:|||.:::.|.|.:|||||..:.
Human   311 VAQTDLKEPLKVLGITDMF-DSSKANFAKITTGSENLHVSHILQKAKIEVSEDGTKASAATTAIL 374

  Fly   336 RRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            ..:.|      ||. ||.|.||.:.|..|.  .:.|.|.|.:|
Human   375 IARSS------PPW-FIVDRPFLFFIRHNPTGAVLFMGQINKP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 102/363 (28%)
SERPINE2XP_005246698.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.